Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR3 IGR514 IGR510 IGR511 IGR513 IGR512 IGR2 IGR1 IGR515 rpL34,rpmH, - UU604 rnpA, - UU603 ksgA, - UU601 UU602 UU598 gluS,gltX,syE, - UU599 rpL31, - UU002 rpiB, - UU006 hemK, - UU004 prfA, - UU003 dnaA, - UU001 rpL34,rpmH, - UU604 rnpA, - UU603 ksgA, - UU601 UU602 UU598 gluS,gltX,syE, - UU599 rpL31, - UU002 rpiB, - UU006 hemK, - UU004 prfA, - UU003 dnaA, - UU001 Type: tandem, Name:  - 4 Type: tandem, Name:  - 373 Type: tandem, Name:  - 376 Type: tandem, Name:  - 3 Type: tandem, Name:  - 371 Type: tandem, Name:  - 377 Type: tandem, Name:  - 390 Type: tandem, Name:  - 1 Type: tandem, Name:  - 375 Type: tandem, Name:  - 372 Type: tandem, Name:  - 6 Type: tandem, Name:  - 2 Type: tandem, Name:  - 374 Type: tandem, Name:  - 5 rnpA, - UU603 ksgA, - UU601 UU602 UU598 gluS,gltX,syE, - UU599 UU600 UU600 rpL34,rpmH, - UU604 rpL31, - UU002 hemK, - UU004 prfA, - UU003 dnaA, - UU001 hemK, - UU005 hemK, - UU005 rpiB, - UU006
* Calculated from Protein Sequence

Gene ID: UU604

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpL34  rpmH  

Definition:
50S ribosomal protein L34

Gene Start:
751549

Gene Stop:
751403

Gene Length:
147

Molecular Weight*:
5687

pI*:
0.00

Net Charge*:
16.45

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular assembly; Ribosome assembly

Comment:
See Prosite PDOC00626.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to 50S ribosomal protein L34 sequences; e.g. residues 1-43 are 79% similar to RL34_BACST; residues 1-47 are 74% similar to RL34_PROMI; and residues 1-45 are 75% similar to RL34_ECOLI.
BLAST also reveals significant similarity to TP0951, MG466, and CT785, all of which are 50S ribosomal protein L34 sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0230 is ehgpc-yu.
Cog name: 50S ribosomal protein L34.
Functional class: J.
BeTs to e-g-c-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 2-39 are in the 100th percentile of similarity to block BL00784 (Ribosomal protein L34 proteins.)

ProDom Summary:  Protein Domain Search
Residues 1-35 are 85% similar to a defined domain of RL34_BACST; residues 2-40 are 56% similar to a defined domain of RL34_SYNY3.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 1 to 44 (E-value = 9.8e-22) place UU604 in the Ribosomal_L34 family which is described as Ribosomal protein L34 (PF00468)

PDB Hit:


Gene Protein Sequence:
MKRTFQPNNRKRAKVHGFRARMKTKNGRNVLARRRLKGRHSLTVSSEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGAACGTTTCAACCTAATAATCGTAAAAGAGCAAAAGTGCATGG
TTTTCGTGCACGCATGAAAACAAAAAATGGGCGTAATGTTTTAGCTAGAA
GAAGACTTAAAGGGCGTCATAGTCTAACAGTTTCTAGTGAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy