Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR3 IGR514 IGR510 IGR511 IGR513 IGR512 IGR2 IGR1 IGR515 rpL34,rpmH, - UU604 rnpA, - UU603 ksgA, - UU601 UU602 UU598 gluS,gltX,syE, - UU599 rpL31, - UU002 rpiB, - UU006 hemK, - UU004 prfA, - UU003 dnaA, - UU001 rpL34,rpmH, - UU604 rnpA, - UU603 ksgA, - UU601 UU602 UU598 gluS,gltX,syE, - UU599 rpL31, - UU002 rpiB, - UU006 hemK, - UU004 prfA, - UU003 dnaA, - UU001 Type: tandem, Name:  - 4 Type: tandem, Name:  - 373 Type: tandem, Name:  - 376 Type: tandem, Name:  - 3 Type: tandem, Name:  - 371 Type: tandem, Name:  - 377 Type: tandem, Name:  - 390 Type: tandem, Name:  - 1 Type: tandem, Name:  - 375 Type: tandem, Name:  - 372 Type: tandem, Name:  - 6 Type: tandem, Name:  - 2 Type: tandem, Name:  - 374 Type: tandem, Name:  - 5 rnpA, - UU603 ksgA, - UU601 UU602 UU598 gluS,gltX,syE, - UU599 UU600 UU600 rpL34,rpmH, - UU604 rpL31, - UU002 hemK, - UU004 prfA, - UU003 dnaA, - UU001 hemK, - UU005 rpiB, - UU006 hemK, - UU005
* Calculated from Protein Sequence

Gene ID: UU603

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rnpA  

Definition:
ribonuclease P protein component

Gene Start:
751397

Gene Stop:
751056

Gene Length:
342

Molecular Weight*:
13265

pI*:
11.40

Net Charge*:
18.17

EC:
3.1.26.5  

Functional Class:
transcription; RNA processing  

Pathway: pathway table

Comment:
See Prosite PDOC00558.

From Prosite:

Ribonuclease P (EC 3.1.26.5) (RNase P) [1,2,3] is a site specific endonuclease that generates mature tRNAs by cleaving-off the leader sequences at their 5'ends. In bacteria RNase P is known to be composed of two components: a large (about 400 base pairs) RNA (gene rnpB) and a small protein (119 to 133 amino acids) (gene rnpA). The RNA moiety of RNase P carries the catalytic activity; the function of the protein component is not yet clear although it may act as an electrostatic screen allowing the highly negatively charged RNA enzyme-substrate complex to fold into the catalytic conformation.

[ 1] Pace N.R., Smith D.
J. Biol. Chem. 265:3587-3590(1990).
[ 2] Altman S.
J. Biol. Chem. 265:20053-20056(1990).
[ 3] Brown J.W., Pace N.R.
Nucleic Acids Res. 20:1451-1456(1992).



Blast Summary:  PSI-Blast Search
Few hits to ribonuclease P protein component sequences; e.g. residues 6-93 are 35% similar to RNPA_MYCGE; residues 17-93 are 31% similar to RNPA_MYCPN; residues 20-90 are 32% similar to RNPA_COXBU; and residues 27-113 are 32% similar to RNPA_HAEIN.
BLAST also reveals significant similarity to MG464, a probable ribonuclease P component. No significant similarity to C.trachomatis or T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0594 is ehgpc---.
Cog name: RNase P protein component.
Functional class: L.
BeTs to -hg-c---.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 1-22, 46-83, and 35-72 are in the 99.97th percentile of similarity to blocks BL0064A,B (Bacterial Ribonuclease P protein component proteins.)

ProDom Summary:  Protein Domain Search
Residues 6-93 are 35% similar to a defined domain of RNPA_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 1 to 108 (E-value = 2.5e-16) place UU603 in the Ribonuclease_P family which is described as Ribonuclease P (PF00825)

PDB Hit:
gi|4699709|pdb|1A6F| Rnase P Protein From Bacillus Subtilis

Gene Protein Sequence:
MANFISLKKNEDILDTIKKQQKIHSNQIVVYFRKTNLKNVRLAISISKKK
FKLATQRNRIRRLIKAWFIAADIPIKSYDIVVLVKPSFIDGSFVLNCNNL
KIILQRIINKEKR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAATTTTATTAGTCTAAAAAAAAATGAAGATATACTTGATACAAT
TAAGAAACAACAAAAAATTCATTCTAATCAAATCGTAGTTTATTTTCGTA
AAACCAATCTAAAAAATGTTCGCTTAGCTATAAGCATTTCTAAAAAAAAG
TTTAAATTAGCAACACAACGCAATCGAATTCGACGCCTGATTAAAGCATG
GTTTATTGCTGCTGATATTCCCATTAAAAGTTATGATATTGTAGTCTTAG
TGAAACCATCGTTTATTGATGGTTCTTTTGTTTTAAATTGTAATAATCTT
AAAATAATTCTTCAACGAATTATTAACAAAGAAAAAAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy