Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR508 IGR514 IGR510 IGR511 IGR513 IGR509 IGR512 IGR2 IGR1 IGR515 rpL34,rpmH, - UU604 rnpA, - UU603 rpoE, - UU597 ksgA, - UU601 tsr,fba,cbbA,alf, - UU596 UU602 UU598 gluS,gltX,syE, - UU599 rpL31, - UU002 prfA, - UU003 dnaA, - UU001 rpL34,rpmH, - UU604 rnpA, - UU603 rpoE, - UU597 ksgA, - UU601 tsr,fba,cbbA,alf, - UU596 UU602 UU598 gluS,gltX,syE, - UU599 rpL31, - UU002 prfA, - UU003 dnaA, - UU001 Type: tandem, Name:  - 371 Type: tandem, Name:  - 376 Type: tandem, Name:  - 370 Type: tandem, Name:  - 374 Type: tandem, Name:  - 1 Type: tandem, Name:  - 375 Type: tandem, Name:  - 373 Type: tandem, Name:  - 2 Type: tandem, Name:  - 377 Type: tandem, Name:  - 372 rnpA, - UU603 rpoE, - UU597 ksgA, - UU601 tsr,fba,cbbA,alf, - UU596 UU602 UU598 gluS,gltX,syE, - UU599 UU600 UU600 rpL34,rpmH, - UU604 rpL31, - UU002 prfA, - UU003 dnaA, - UU001
* Calculated from Protein Sequence

Gene ID: UU601

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ksgA  

Definition:
dimethyladenosine transferase

Gene Start:
749804

Gene Stop:
749031

Gene Length:
774

Molecular Weight*:
29767

pI*:
10.10

Net Charge*:
11.06

EC:
2.1.1.-  

Functional Class:
other categories; drug and analog sensitivity  
transcription; RNA modification  

Pathway: pathway table
Alkaloid biosynthesis I
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Comment:
This enzyme dimethylates adjacent adenosine residues in
a particular region of 16S rRNA. Inactivation of the enzyme
leads to kasgamycin resistance. KSGA enzymes are functionally related to
ERM enzymes (EC 2.1.1.48).

See Prosite PDOC00871.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to dimethyladenosine transferases; e.g. residues 2-255 are 36% similar to KSGA_MYCCA; residues 1-255 are 32% similar to KSGA_BACSU; and residues 2-255 are 29% similar to KSGA_HAEIN. Also similar to KSGA_ECOLI and DIM1_YEAST.
BLAST also reveals significant similarity to MG463, CT354, and TP0337, all of which are dimethyladenosine transferases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0030 is ehgpcmyu.
Cog name: rRNA (adenosine-N6,N6-)-dimethyltransferase.
Functional class: J.
BeTs to -hg-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 12-57, 100-113, and 165-186 are in the 99.98th percentile of similarity to blocks BL01131A-C (Ribosomal RNA adenine dimethylases proteins.)

ProDom Summary:  Protein Domain Search
Residues 99-253 are 38% similar to a defined domain of O51536_BORBU, a dimethyladenosine transferase.
Residues 80-223 are 38% similar to a defined domain of KSGA_MYCCA.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 1 to 257 (E-value = 5.9e-45) place UU601 in the RrnaAD family which is described as Ribosomal RNA adenine dimethylase (PF00398)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
40  
124
non-globular  
160  
257

PDB Hit:
gi|4699789|pdb|2ERC|A Chain A, Crystal Structure Of Ermc' A Rrna-Methyl Transferase

Gene Protein Sequence:
MGQNFLLSNNIKNKIVDVANINKDDLILEIGPGWGAITEILVQKTNILIA
IELDKRLYAHLKTYIKTSNFHIINNDVLCVDLDNLILDYNNTQKIQKIKV
VANLPYAISSKIVLKIIQSKLINDAYIMVQKEMAERIGAKVNTRGYNAFT
VLVQLFCKTKILFEVNAKEFHPQPKVQSAVIHLENLHNSVNFNIEELGKF
LRICFLNKRKKLKNNLSNIYDIKIINQMFIDYNLDMNLRAENIEPKMFLK
LFNYLNR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGGCAAAACTTCTTATTGTCTAATAACATAAAAAATAAAATTGTAGA
TGTGGCGAATATTAATAAAGATGATCTTATATTAGAAATTGGTCCAGGGT
GAGGAGCAATTACTGAAATTCTTGTACAAAAAACAAATATTTTAATTGCT
ATTGAATTAGATAAAAGACTATATGCACACTTAAAAACATACATAAAAAC
AAGTAATTTTCATATAATAAATAATGATGTATTATGTGTAGATTTAGATA
ATTTGATTTTAGATTACAATAATACTCAAAAAATTCAAAAAATTAAAGTT
GTTGCAAATCTTCCATATGCAATATCTTCAAAGATAGTTTTAAAAATTAT
TCAATCAAAATTAATTAATGATGCTTATATTATGGTTCAAAAAGAAATGG
CTGAACGAATTGGTGCTAAAGTAAATACACGTGGTTATAATGCTTTTACT
GTTTTAGTACAATTATTCTGTAAAACAAAAATTCTATTCGAAGTTAATGC
TAAAGAATTTCATCCCCAACCTAAAGTTCAAAGTGCTGTCATTCATCTTG
AAAATCTTCATAATAGTGTGAATTTTAATATTGAAGAATTAGGTAAATTT
TTACGGATTTGTTTTTTAAATAAACGAAAAAAGTTAAAAAATAACTTATC
TAATATTTATGATATTAAAATAATTAATCAAATGTTTATTGATTATAATT
TAGATATGAATTTACGAGCTGAAAACATTGAACCAAAAATGTTTCTAAAA
CTCTTTAATTATTTGAATAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy