Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR508 IGR514 IGR506 IGR510 IGR507 IGR511 IGR513 IGR509 IGR512 IGR515 rpL34,rpmH, - UU604 rnpA, - UU603 rpoE, - UU597 tdk,KitH, - UU594 ksgA, - UU601 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU602 UU598 gluS,gltX,syE, - UU599 dnaA, - UU001 rpL34,rpmH, - UU604 rnpA, - UU603 rpoE, - UU597 tdk,KitH, - UU594 ksgA, - UU601 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU602 UU598 gluS,gltX,syE, - UU599 dnaA, - UU001 Type: tandem, Name:  - 371 Type: tandem, Name:  - 376 Type: tandem, Name:  - 370 Type: tandem, Name:  - 374 Type: tandem, Name:  - 368 Type: tandem, Name:  - 428 Type: tandem, Name:  - 375 Type: tandem, Name:  - 373 Type: tandem, Name:  - 369 Type: tandem, Name:  - 377 Type: tandem, Name:  - 372 rnpA, - UU603 rpoE, - UU597 tdk,KitH, - UU594 ksgA, - UU601 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU602 UU598 gluS,gltX,syE, - UU599 UU600 UU600 rpL34,rpmH, - UU604 dnaA, - UU001
* Calculated from Protein Sequence

Gene ID: UU599

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gluS  gltX  syE  

Definition:
glutamyl-tRNA synthetase

Gene Start:
748210

Gene Stop:
746762

Gene Length:
1449

Molecular Weight*:
55898

pI*:
8.20

Net Charge*:
5.40

EC:
6.1.1.17  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glutamate metabolism
Porphyrin and chlorophyll metabolism

Comment:
This protein, a monomer in B.subtilis, belongs to Class I aminoacyl-tRNA synthetases.

Reaction:
ATP + L-GLUTAMATE + TRNA(GLU) =
AMP + PYROPHOSPHATE + L-GLUTAMYL-TRNA(GLU).

The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glutamyl-tRNA synthetases; e.g. residues 2-468 are 49% similar to SYE_MYCGE; residues 3-470 are 41% similar to SYE_BACST; and residues 1-470 are 31% similar to SYE_HAEIN. Also similar to SYE_TOBAC, SYE_ECOLI, SYE_SYNY3, and SYEM_YEAST.
BLAST also reveals significant similarity to MG462, TP0673, and CT445, all of which are glutamyl-tRNA synthetases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0008 is EHgpcmYU.
Cog name: Glutamyl- and glutaminyl-tRNA synthetases.
Functional class: J.
BeTs to -hg-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 11-20 and 249-259 are in the 95.01th percentile of similarity to blocks BL00178A,B (Aminoacyl-transfer RNA synthetases class-I proteins.)

ProDom Summary:  Protein Domain Search
Residues 2-313 are 59% similar to a defined domain of SYE_MYCGE, a glutamyl-tRNA synthetase.
Residues 9-104 are 56% simialr to a defined domain of SYE_BACSU, an isoleucyl-tRNA synthetase.
Residues 320-474 are 40% similar to a defined domain of SYE_MYCPU, a glutamyl-tRNA synthetase.

Paralogs:  Local Blast Search
UU143, a conserved hypothetical protein, is a possible paralog.

Pfam Summary:  Pfam Search
Residues 2 to 323 (E-value = 5.4e-150) place UU599 in the tRNA-synt_1c family which is described as tRNA synthetases class I (E and Q), catalytic domain (PF00749)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
87  
123
non-globular  
315  
441

PDB Hit:
gi|1311358|pdb|1GLN| Mol_id: 1; Molecule: Glutamyl-Trna Synthetase; Chain: Null

Gene Protein Sequence:
MKIRTRYAPSPTGYLHIGGARTALFNYLLAKAYGGDFIIRIEDTDIERNV
EGGINSQLDFLAWMGIIPDESIRNPKAFGPYIQSEKLKHYEKLALDLVDQ
KKAYFCFCSKEQLDADRELAEKSHQTPKYKRHCLNLDKKTIESNLLQNKE
YTIRLKINENMEYSWDDLIRGKISIPGSALTDPVILKSNKIAMYNFAVVI
DDYEMQISHVIRGEEHISNTPYQLAIAQALNYDITKIKYGHLSIIVDETG
KKLSKRNLSLKQFVSDYEKDGYWPHAITNFVALLGWSPKNNDEIMSLETM
IKNFDINNLSKSPAFFDINKMNWFSTQYFNNITQEEFINFIKKHSLTKEL
VLNDYTFINKCLLFKSHIINLKQLIDLVIEQFNCDKKVLASDVDYIKKNQ
LITVVRVFYEQLIINDEFNEEFIKEIIKKVQIITNNKGANLYMPIRIATT
FSSHGPELAKTICYLGREKVLKNLINILKILD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTAGAACACGTTATGCTCCATCACCAACCGGTTATTTACATAT
TGGAGGAGCGCGAACAGCTTTATTTAATTATTTACTAGCAAAAGCTTATG
GTGGGGATTTTATTATTCGTATTGAAGATACTGATATTGAAAGAAATGTG
GAAGGGGGAATTAATTCCCAACTAGATTTTTTAGCATGAATGGGTATTAT
TCCAGACGAATCAATTCGTAATCCTAAAGCTTTTGGCCCATATATCCAAT
CTGAAAAATTAAAACATTATGAAAAATTAGCATTAGATCTAGTTGATCAA
AAAAAAGCTTATTTTTGTTTTTGTAGTAAAGAACAATTAGATGCAGATCG
CGAATTAGCTGAAAAATCACATCAAACACCTAAATACAAACGGCACTGTT
TAAATTTAGATAAAAAAACAATTGAAAGTAACTTATTACAAAATAAAGAA
TACACAATTCGTTTAAAAATTAATGAAAATATGGAATATAGCTGGGATGA
TTTAATTCGGGGTAAAATTAGTATTCCAGGTAGTGCTTTAACTGATCCTG
TCATTTTAAAATCAAATAAGATTGCAATGTATAATTTTGCAGTTGTAATT
GACGATTATGAAATGCAAATTTCACATGTCATTCGTGGAGAAGAGCATAT
TTCTAATACACCTTATCAATTAGCGATTGCTCAGGCCTTAAATTATGATA
TAACAAAAATTAAATATGGTCATTTGTCAATTATTGTTGATGAGACAGGA
AAAAAATTATCAAAGCGAAATTTATCTTTAAAACAGTTTGTGTCTGATTA
TGAAAAAGATGGTTATTGGCCACATGCTATTACAAACTTTGTTGCATTAT
TAGGTTGAAGCCCAAAAAATAACGATGAAATAATGAGTTTAGAAACGATG
ATTAAAAATTTTGATATCAATAATTTATCAAAATCCCCCGCCTTTTTTGA
TATCAATAAAATGAATTGGTTTTCAACACAATATTTTAATAATATTACCC
AAGAAGAATTTATCAATTTTATAAAGAAACATTCATTAACTAAAGAATTA
GTTTTGAATGATTATACTTTTATTAATAAATGTCTATTATTTAAATCTCA
TATTATTAATTTAAAACAACTAATTGATTTAGTAATTGAACAATTTAATT
GTGATAAAAAAGTATTAGCATCAGATGTAGATTATATTAAAAAAAACCAA
TTAATAACTGTTGTTCGTGTTTTTTATGAACAATTAATAATTAATGATGA
ATTTAATGAAGAATTTATAAAAGAAATAATTAAAAAAGTTCAAATAATAA
CTAATAACAAAGGTGCTAATTTATACATGCCAATTCGTATTGCAACTACA
TTTAGTTCGCATGGTCCAGAATTAGCTAAAACAATTTGTTATTTAGGACG
CGAAAAAGTATTAAAAAATTTAATAAATATTTTAAAAATTTTGGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy