Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR508 IGR506 IGR510 IGR507 IGR504 IGR511 IGR505 IGR503 IGR509 IGR512 IGR502 UU593 rpoE, - UU597 tdk,KitH, - UU594 UU591 ksgA, - UU601 UU592 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU602 UU598 gluS,gltX,syE, - UU599 UU593 rpoE, - UU597 tdk,KitH, - UU594 UU591 ksgA, - UU601 UU592 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU602 UU598 gluS,gltX,syE, - UU599 Type: tandem, Name:  - 368 Type: tandem, Name:  - 373 Type: tandem, Name:  - 367 Type: tandem, Name:  - 371 Type: tandem, Name:  - 365 Type: tandem, Name:  - 428 Type: tandem, Name:  - 372 Type: tandem, Name:  - 370 Type: tandem, Name:  - 366 Type: tandem, Name:  - 374 Type: tandem, Name:  - 369 UU593 rpoE, - UU597 tdk,KitH, - UU594 UU591 ksgA, - UU601 UU592 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU602 UU598 gluS,gltX,syE, - UU599 UU600 UU600
* Calculated from Protein Sequence

Gene ID: UU597

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpoE  

Definition:
probable DNA-directed RNA polymerase delta subunit

Gene Start:
745488

Gene Stop:
745006

Gene Length:
483

Molecular Weight*:
18754

pI*:
4.00

Net Charge*:
-25.73

EC:
2.7.7.6  

Functional Class:
transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Comment:
DNA-dependent RNA polymerase catalyzes the transcription of DNA
into RNA using the four ribnucleoside triphosphates as substrates.

Activity: N nucleoside triphosphate = N pyrophosphate + RNA(N).

Bacterial RNA polymerase consists of a sigma factor and a core enzyme composed of two alpha, one beta and one beta' chains. The alpha, beta, and beta' chains in U.u. are UU257, UU187, and UU188 respectively. The sigma factor is UU349. There is also a probable delta sequence: UU597.

Reference: Eur J Biochem. 1981 Jun 1;116(3):621-9.

Blast Summary:  PSI-Blast Search
Several weak hits to probable DNA-directed RNA polymerase delta subunit sequences; e.g. residues 23-137 are 28% similar to RPOE_MYCGE; residues 23-123 are 29% similar to RPOE_MYCPN; and residues 23-140 are 24% similar to RPOE_BACSU.
No significant similarity to C.trachomatis or T.pallidum.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 19-129 are 28% similar to a defined domain of RPOE_MYCPN.
Residues 5-80 are 31% similar to a defined domain of RPOE_BACSU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 1 to 159 (E-value = 4.9e-85) place UU597 in the RNA_pol_delta family which is described as DNA-directed RNA polymerase delta subunit (PF05066)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
70  
160

PDB Hit:


Gene Protein Sequence:
MSRQLVDIAYNAIKNNKIYNKKPFTFDDIINEIVKNSNVNLVEVNSQLGV
LYTTLIQDTRFISIGDLEWNLRERLSLDEITKINNAMYEVGLYKDSDREE
DEHEIVKNDKLTQSKEQEESDEVSSLSDFVGYEDEDEEFKNNNTSNKDEI
EDEEELEEEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCCGTCAATTAGTTGATATTGCTTATAATGCAATAAAAAATAATAA
AATTTATAACAAAAAACCATTTACTTTTGATGATATTATTAATGAAATTG
TCAAGAATAGTAATGTAAATTTAGTAGAAGTTAATTCACAATTAGGTGTT
TTATATACAACTTTAATACAAGATACACGTTTTATTTCAATTGGAGATTT
AGAATGAAATTTACGTGAACGATTATCACTAGATGAAATTACAAAAATTA
ATAACGCTATGTATGAAGTTGGTTTATACAAAGATAGTGACCGTGAAGAA
GATGAACATGAAATTGTTAAAAATGATAAATTAACACAATCAAAAGAACA
AGAGGAAAGTGATGAAGTAAGCTCTTTATCTGATTTTGTTGGCTACGAAG
ATGAAGATGAAGAATTTAAAAATAATAATACTTCTAATAAAGATGAAATA
GAAGACGAAGAGGAATTAGAAGAGGAAGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy