Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR508 IGR506 IGR510 IGR507 IGR504 IGR511 IGR505 IGR503 IGR509 IGR502 UU593 rpoE, - UU597 tdk,KitH, - UU594 UU591 ksgA, - UU601 UU592 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU598 gluS,gltX,syE, - UU599 topA,top1, - UU590 UU593 rpoE, - UU597 tdk,KitH, - UU594 UU591 ksgA, - UU601 UU592 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU598 gluS,gltX,syE, - UU599 topA,top1, - UU590 Type: tandem, Name:  - 367 Type: tandem, Name:  - 372 Type: tandem, Name:  - 366 Type: tandem, Name:  - 370 Type: tandem, Name:  - 364 Type: tandem, Name:  - 428 Type: tandem, Name:  - 371 Type: tandem, Name:  - 369 Type: tandem, Name:  - 365 Type: tandem, Name:  - 373 Type: tandem, Name:  - 368 UU593 rpoE, - UU597 tdk,KitH, - UU594 UU591 ksgA, - UU601 UU592 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU598 gluS,gltX,syE, - UU599 topA,top1, - UU590 UU600 UU600
* Calculated from Protein Sequence

Gene ID: UU596

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tsr  fba  cbbA  alf  

Definition:
fructose-bisphosphate aldolase

Gene Start:
745001

Gene Stop:
744129

Gene Length:
873

Molecular Weight*:
31699

pI*:
6.80

Net Charge*:
-0.88

EC:
4.1.2.13  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Fructose and mannose metabolism
Glycolysis / Gluconeogenesis
Pentose phosphate cycle

Comment:
This enzyme is the sixth step in glycolysis.

See Prosite PDOC00523.

From Prosite:

Fructose-bisphosphate aldolase (EC 4.1.2.13) [1,2] is a glycolytic enzyme that
catalyzes the reversible aldol cleavage or condensation of fructose-1,6-
bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate.
There are two classes of fructose-bisphosphate aldolases with different
catalytic mechanisms. Class-II aldolases [2], mainly found in prokaryotes and
fungi, are homodimeric enzymes which require a divalent metal ion - generally
zinc - for their activity.

[ 1] Perham R.N.
Biochem. Soc. Trans. 18:185-187(1990).
[ 2] Marsh J.J., Lebherz H.G.
Trends Biochem. Sci. 17:110-113(1992).


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to fructose-bisphosphate aldolases; e.g. residues 4-288 are 49% similar to ALF_MYCGE; residues 4-288 are 47% similar to ALF_STRPN; and residues 4-288 are 42% similar to ALF_BACST.
BLAST also reveals significant similarity to MG023 and TP0662, both of which are fructose-bisphosphate aldolases. No significant similarity to C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0191 is Ehgpc-yu.
Cog name: Hexose-biphosphate aldolases.
Functional class: G.
BeTs to e-g-c-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 14-272 span seven regions of similarity to blocks BL00602A-D,F-H (Fructose-bisphosphate aldolase class-II proteins.)
Residues 94-106, 101-143, and 199-216 are in the 98.54th percentile of similarity to blocks BL0107A,F,G (Acetate and butyrate kinases family proteins.)

ProDom Summary:  Protein Domain Search
Residues 4-288 are 52% similar to a defined domain of ALF_MYCGE, a fructose-bisphosphate aldolase.



Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 3 to 289 (E-value = 3.2e-109) place UU596 in the F_bP_aldolase family which is described as Fructose-bisphosphate aldolase class-II (PF01116)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
107  
154

PDB Hit:
gi|2392284|pdb|1DOS|A Chain A, Structure Of Fructose-Bisphosphate Aldolase

Gene Protein Sequence:
MSPLVNAKKMIQNAYENHYAVAAININNLEWIKAALLAAQETNSPLLLAT
SEGAVKYMGGYDNCYAMVVNLIKQMNIKTPVCLHLDHGTYEGCIKAINAG
YSSIMYDGSKLSIEENIKNTKELLTITKLKGVSVEVEVGSIGGTEDGITS
EGELANIDDCYQMCLLDIDMLACGIGNIHGIYPKNWKGLNFNLLKEINNK
VNKPIVLHGGSGISDEQILKAINLGVAKININTECQIAFSNALQDHLTKA
GDLILSKQYDPRKILAYGVDAIKNTIIDKFTKFNSLNKIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCACCATTAGTTAATGCCAAAAAAATGATTCAAAATGCTTATGAAAA
TCATTATGCAGTGGCTGCAATTAATATCAATAATTTAGAATGAATTAAAG
CAGCATTATTAGCAGCTCAAGAAACAAACTCTCCTCTTTTATTAGCGACA
TCTGAAGGTGCCGTAAAATATATGGGTGGTTATGATAATTGTTATGCAAT
GGTTGTTAATTTAATAAAACAAATGAATATTAAAACTCCTGTTTGTTTGC
ATTTAGATCATGGTACATATGAAGGATGTATAAAAGCTATTAATGCTGGT
TATTCCTCAATTATGTATGATGGATCAAAACTTTCGATCGAAGAAAACAT
TAAAAACACTAAAGAACTTTTGACAATAACTAAATTAAAAGGTGTATCAG
TAGAAGTTGAAGTTGGTTCAATTGGTGGGACAGAAGATGGGATTACTTCA
GAAGGTGAATTAGCTAATATCGACGATTGTTATCAAATGTGTTTATTAGA
TATTGATATGTTAGCGTGTGGTATTGGAAATATTCACGGAATATATCCTA
AAAATTGAAAAGGTTTAAATTTTAATTTATTAAAAGAAATTAACAATAAA
GTGAATAAACCAATTGTTTTACACGGAGGTTCTGGTATTAGTGATGAACA
AATTTTAAAAGCAATTAATTTGGGTGTAGCAAAAATTAATATTAATACAG
AATGTCAAATTGCATTTTCAAATGCATTACAAGATCACTTAACAAAAGCA
GGTGATTTAATTCTTTCTAAACAGTATGATCCACGAAAAATTTTGGCTTA
TGGTGTGGACGCAATTAAAAATACAATCATTGATAAATTCACTAAGTTTA
ATAGTTTAAATAAAATAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy