Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-2 IGR508 IGR506 IGR510 IGR507 IGR504 IGR501 IGR505 IGR503 IGR509 IGR502 IGR500 trx, - UU589 UU593 rpoE, - UU597 tdk,KitH, - UU594 UU591 UU592 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU598 gluS,gltX,syE, - UU599 topA,top1, - UU590 trx, - UU589 UU593 rpoE, - UU597 tdk,KitH, - UU594 UU591 UU592 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU598 gluS,gltX,syE, - UU599 topA,top1, - UU590 Type: tandem, Name:  - 366 Type: tandem, Name:  - 371 Type: tandem, Name:  - 365 Type: tandem, Name:  - 369 Type: tandem, Name:  - 363 Type: tandem, Name:  - 370 Type: tandem, Name:  - 368 Type: tandem, Name:  - 364 Type: tandem, Name:  - 428 Type: tandem, Name:  - 367 trx, - UU589 UU593 rpoE, - UU597 tdk,KitH, - UU594 UU591 UU592 tsr,fba,cbbA,alf, - UU596 gtp1, - UU595 UU598 gluS,gltX,syE, - UU599 topA,top1, - UU590
* Calculated from Protein Sequence

Gene ID: UU594

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tdk  KitH  

Definition:
thymidine kinase

Gene Start:
743005

Gene Stop:
742334

Gene Length:
672

Molecular Weight*:
25352

pI*:
8.90

Net Charge*:
6.21

EC:
2.7.1.21  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; nucleotide and nucleoside interconversions  

Pathway: pathway table
Pyrimidine metabolism

Comment:
See Prosite PDOC00524.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to thymidine kinases; e.g. residues 9-200 are 46% similar to KITH_BACSU; residues 12-194 are 43% similar to KITH_MYCPN; and residues 8-208 are 36% similar to KITH_HUMAN.
BLAST also reveals significant similarity to MG034, a thymidine kinase. No similarity to T.pallidum or C.trachomatis.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 14-46, 89-103, 110-164, and 181-195 are in the 99.98th percentile of similarity to blocks BL00603A-D (Thymidine kinase cellular-type proteins.)


ProDom Summary:  Protein Domain Search
Residues 12-195 are 47% similar to a defined domain of KITH_BACSU, a thymidine kinase.
Residues 76-210 are 33% similar to a defined domain of O51731_BORBU, a thymidine kinase.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 12 to 195 (E-value = 4.5e-68) place UU594 in the TK family which is described as Thymidine kinase (PF00265)

PDB Hit:


Gene Protein Sequence:
MAKVNAFSKKIGWIELITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKI
DTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQF
FDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLT
AICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNR
PYLNSNSEEFIKFFKNKKRNKNI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAAAGTGAATGCATTTTCAAAAAAAATAGGATGAATAGAATTAAT
TACTGGCCCAATGTTTGCTGGAAAAACAGCAGAGTTAATTCGTCGCTTAC
ATCGTTTAGAATATGCAGATGTTAAATATTTGGTTTTTAAACCTAAAATT
GATACTAGATCTATTAGAAATATCCAATCACGAACAGGAACGTCTTTACC
ATCAGTTGAAGTAGAAAGCGCACCAGAAATTTTAAATTATATTATGTCAA
ACAGTTTTAATGATGAAACAAAAGTTATTGGCATTGATGAGGTTCAATTT
TTTGATGATCGGATTTGTGAAGTTGCAAATATTTTAGCAGAAAATGGTTT
TGTTGTTATTATTTCAGGATTAGATAAAAATTTTAAAGGCGAGCCTTTTG
GTCCAATTGCTAAACTTTTTACTTATGCTGATAAAATTACAAAACTAACA
GCGATATGTAATGAGTGTGGCGCTGAAGCAACGCATTCATTGCGTAAGAT
TGATGGTAAACACGCTGACTATAATGATGATATTGTTAAAATTGGCTGTC
AGGAATTCTATTCTGCTGTTTGTCGTCATCATCATAAGGTACCTAATCGT
CCTTATTTAAATAGTAATTCTGAGGAATTTATTAAATTTTTTAAAAATAA
AAAACGAAATAAAAATATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy