Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-2 IGR497 IGR501 IGR498 IGR499 IGR496 IGR500 IGR495 ptsH,pthP, - UU587 trx, - UU589 deoC, - UU585 UU584 cls, - UU588 UU583 tktA, - UU586 topA,top1, - UU590 ptsH,pthP, - UU587 trx, - UU589 deoC, - UU585 UU584 cls, - UU588 UU583 tktA, - UU586 topA,top1, - UU590 Type: tandem, Name:  - 363 Type: tandem, Name:  - 362 Type: tandem, Name:  - 426 Type: tandem, Name:  - 360 Type: tandem, Name:  - 456 Type: tandem, Name:  - 425 Type: tandem, Name:  - 361 Type: tandem, Name:  - 389 ptsH,pthP, - UU587 trx, - UU589 deoC, - UU585 UU584 cls, - UU588 UU583 tktA, - UU586 topA,top1, - UU590
* Calculated from Protein Sequence

Gene ID: UU586

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tktA  

Definition:
transketolase

Gene Start:
735558

Gene Stop:
733597

Gene Length:
1962

Molecular Weight*:
73526

pI*:
8.20

Net Charge*:
5.70

EC:
2.2.1.1  

Functional Class:
energy metabolism; pentose phosphate pathway  

Pathway: pathway table
Carbon fixation
Pentose phosphate cycle

Comment:
See Prosite PDOC00635.

From Prosite:

Transketolase (EC 2.2.1.1) (TK) catalyzes the reversible transfer of a two-carbon ketol unit from xylulose 5-phosphate to an aldose receptor, such as ribose 5-phosphate, to form sedoheptulose 7-phosphate and glyceraldehyde 3-phosphate. This enzyme, together with transaldolase, provides a link between the glycolytic and pentose-phosphate pathways.

TK requires thiamin pyrophosphate as a cofactor. In most sources where TK has been purified, it is a homodimer of approximately 70 Kd subunits. TK sequences from a variety of eukaryotic and prokaryotic sources show that the enzyme has been evolutionarily conserved.



Blast Summary:  PSI-Blast Search
Numerous highly significant hits to transketolases; e.g. residues 3-647 are 43% similar to TKT_MYCGE; residues 5-650 are 40% similar to TKT_BACSU; and residues 5-646 are 35% similar to TKT1_YEAST.
BLAST also reveals significant similarity to MG066, CT750, and TP0560, all of which are predicted transketolases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0021 is EHgpCMYu.
Cog name: Transketolase/pyruvate dehydrogenase E1 subunit.
Functional class: G/C.
BeTs to -hg-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 5-570 span six regions of similarity to blocks BL00801A-F (Transketolase proteins.)

ProDom Summary:  Protein Domain Search
Residues 11-249 are 52% similar to a defined domain of TKT_MYCPN.
Residues 368-650 are 42% similar to a defined domain of TKT_BACSU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 2 to 329 (E-value = 8.6e-92) place UU586 in the Transketolase_N family which is described as Transketolase, thiamine diphosphate binding domain (PF00456)
Residues 345 to 513 (E-value = 1.8e-42) place UU586 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
212  
293
coil-coil  
321  
364

PDB Hit:
gi|809440|pdb|1TKA|A Chain A, Transketolase (E.C.2.2.1.1) Complexed With 3'-Deazo-Thiamin Diphosphate And Calcium

Gene Protein Sequence:
MNRYVNAMRSLALQAINKAKQGHSGMSISAAPIVYTLYKGLMTISKSHPK
WFNRDRLVLSAGHGSMALYPVFYFSSLLTLDDIKNFRNDNYLTPGHPEVL
ANNYIDASTGPLGQGVANAVGMAITESYLRTEFATLKGVIDHYTYCIVGD
GDLQEGICYEAMSIAGKLKLSKLIILHDSNDYQLDSAVSDVNIEDLKMRV
ESMGWNYLKTDNNPENIFKAIAEAKWKKNVKPTFIEVKTIIGEGTSFENS
NEAHAAAISNDELEKFSKRFHIKTNNFEFHQEIFDHFFFNVVARGESAYN
QWQQLVDQYMQTNPEQMQRLLNYINGNYEDLNKLLDENKITNLNDSTRSY
LKQYFNQLKDLKSALVLSADLAKSTFTKIGEGAFNDNHKNPYIKFGIREF
AMAGAMNGISLHQGVKAIGGTFLAFSDYMKPAIRLAAISNLANLFIFSHD
SYAVGGDGPTHQPVDQLPMLRAIPNVEVIRPADHYEVKYALSYSFKQKQK
PICLITSRQTIKQINDQKPQDFSKGAYIINSPFSFCKDVDYTIIASGSEV
SLANDAAKELFEKHKLKIKVISAFNLNLFLRQKPEDIKSLLASKNGLLAI
EASSEMLWWKLSIYTNKFIQIAANQFGRSADGDKLMNEFGFSVKNIINQL
LNQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCGTTATGTTAACGCAATGCGTTCACTTGCTTTACAGGCTATTAA
TAAAGCAAAGCAAGGTCACAGTGGAATGAGTATTTCAGCTGCACCTATTG
TTTATACCCTTTATAAGGGATTAATGACTATTTCAAAATCACATCCAAAG
TGATTTAATCGCGATCGTTTGGTTTTATCAGCTGGTCATGGATCGATGGC
ATTATATCCTGTTTTTTATTTTTCATCATTATTAACATTAGATGACATTA
AAAATTTTCGCAATGATAATTATTTAACACCAGGTCATCCTGAAGTGTTG
GCTAATAATTATATTGATGCATCAACAGGACCACTAGGGCAAGGGGTTGC
TAATGCAGTTGGTATGGCAATTACTGAAAGTTATTTAAGAACTGAATTTG
CTACTCTTAAAGGTGTTATTGATCATTATACTTATTGTATTGTTGGCGAT
GGGGACCTACAAGAGGGAATTTGTTATGAGGCAATGAGTATTGCTGGAAA
ATTAAAATTATCGAAATTAATTATTTTACATGATTCAAATGATTACCAAT
TAGATTCAGCAGTAAGTGATGTTAATATTGAAGATTTAAAAATGCGTGTT
GAATCAATGGGTTGAAATTATCTAAAAACAGATAATAATCCTGAAAATAT
TTTCAAAGCAATTGCTGAAGCTAAATGAAAAAAGAATGTTAAACCAACGT
TTATTGAAGTCAAAACAATCATTGGTGAGGGGACATCTTTTGAAAATAGT
AATGAAGCGCATGCTGCAGCAATTTCTAATGATGAATTAGAAAAATTTTC
TAAGCGTTTTCATATTAAAACAAATAATTTTGAATTTCATCAGGAAATTT
TTGATCACTTCTTTTTTAATGTTGTAGCTCGGGGCGAAAGTGCTTATAAT
CAATGACAACAATTAGTTGACCAATATATGCAAACTAATCCAGAACAAAT
GCAACGTTTATTAAATTATATTAATGGTAATTATGAAGATTTAAATAAAT
TATTAGATGAAAATAAAATTACTAATTTAAATGATTCTACTCGCAGTTAT
TTAAAACAATATTTTAATCAATTAAAAGATTTAAAATCAGCTCTTGTTTT
ATCTGCTGATTTAGCTAAATCAACTTTCACAAAAATAGGCGAAGGCGCTT
TTAACGATAACCATAAAAATCCATATATTAAATTCGGTATTCGTGAATTT
GCTATGGCAGGAGCGATGAATGGAATAAGTTTACATCAAGGCGTTAAAGC
GATAGGAGGCACTTTTTTAGCTTTTTCTGATTATATGAAACCAGCAATTC
GTTTAGCTGCCATTAGTAATTTAGCTAATTTATTTATTTTTAGTCACGAT
AGTTATGCAGTGGGTGGTGATGGACCTACACATCAACCTGTCGATCAATT
ACCAATGTTAAGAGCAATTCCAAATGTAGAAGTAATTCGTCCTGCTGATC
ATTATGAAGTTAAATATGCTCTTTCATATAGTTTTAAACAAAAACAAAAA
CCGATTTGTTTAATTACTTCACGTCAAACTATTAAACAAATTAATGATCA
AAAACCACAAGATTTTAGTAAGGGAGCATATATTATTAATTCGCCTTTTT
CTTTTTGTAAAGATGTAGATTACACGATTATTGCTAGTGGTAGTGAAGTT
AGTTTAGCAAATGACGCAGCAAAAGAACTTTTTGAAAAACATAAACTTAA
AATTAAAGTTATTTCTGCTTTTAACTTAAATTTATTTTTACGTCAAAAAC
CTGAAGATATTAAGAGCCTTTTAGCTTCAAAAAATGGTCTATTAGCAATT
GAAGCATCAAGCGAAATGCTTTGATGAAAATTATCAATTTATACAAATAA
ATTTATACAAATTGCTGCTAATCAATTTGGGCGTAGTGCAGATGGTGATA
AATTAATGAATGAATTTGGTTTTAGTGTTAAAAATATTATTAATCAACTT
TTAAACCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy