Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-2 IGR497 IGR501 IGR498 IGR499 IGR496 IGR500 IGR495 ptsH,pthP, - UU587 trx, - UU589 deoC, - UU585 deaD, - UU582 UU584 cls, - UU588 UU583 tktA, - UU586 topA,top1, - UU590 ptsH,pthP, - UU587 trx, - UU589 deoC, - UU585 deaD, - UU582 UU584 cls, - UU588 UU583 tktA, - UU586 topA,top1, - UU590 Type: tandem, Name:  - 363 Type: tandem, Name:  - 362 Type: tandem, Name:  - 426 Type: tandem, Name:  - 360 Type: tandem, Name:  - 456 Type: tandem, Name:  - 425 Type: tandem, Name:  - 361 Type: tandem, Name:  - 389 ptsH,pthP, - UU587 deoC, - UU585 deaD, - UU582 UU584 cls, - UU588 UU583 tktA, - UU586 topA,top1, - UU590 trx, - UU589
* Calculated from Protein Sequence

Gene ID: UU585

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
deoC  

Definition:
deoxyribose phosphate aldolase

Gene Start:
733585

Gene Stop:
732938

Gene Length:
648

Molecular Weight*:
24094

pI*:
5.30

Net Charge*:
-5.31

EC:
4.1.2.4  

Functional Class:
energy metabolism; sugars  
purines, pyrimidines, nucleosides, and nucleotides; general  

Pathway: pathway table
Pentose phosphate cycle

Comment:
Reaction:
2-DEOXY-D-RIBOSE 5-PHOSPHATE = D-GLYCERALDEHYDE 3-PHOSPHATE + ACETALDEHYDE.

See UU368, a predicted deoA sequence; UU470, a predicted deoD sequence; and UU281, a predicted deoD sequence.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to deoxyribose-phosphate aldolases; e.g. residues 3-212 are 49% similar to DEOC_MYCPN; residues 8-208 are 48% similar to DEOC_BACSU; and residues 2-213 are 44% similar to DEOC_HAEIN. Also similar to DEOC_ECOLI.
BLAST also reveals significant similarity to MG050 and TP0264, both of which are deoxyribose-phosphate aldolases.
No significant similarity to C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0274 is ehgpc---.
Cog name: Deoxyribose-phosphate aldolase.
Functional class: F.
BeTs to -h-pc---.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 3-208 are 50% similar to a defined domain of DEOC_MYCPN.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 2 to 213 (E-value = 1.2e-90) place UU585 in the DeoC family which is described as Deoxyribose-phosphate aldolase (PF01791)

PDB Hit:


Gene Protein Sequence:
MNKYNIYVDHTLLKADASLEEIHKLCEEAEENEFYSVCINPCFVKVAKHY
LLETSVKICTVIGFPLGANTIETKVFETKNAIDLGADEIDMVININQLIN
GNREYCLNEINQIKEVCGDKILKVIVETAFLNREQKEFAAKIILESNADF
IKTSTGFAKEGAKLEDIILWKRILGDVKQIKASGGIKNFEDFKSFIEAGA
TRIGTSSAIKILNNH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAGTATAATATTTATGTAGATCACACATTATTAAAAGCTGACGC
AAGTTTAGAAGAGATTCATAAGTTGTGTGAAGAAGCAGAAGAAAATGAAT
TTTATTCAGTTTGTATTAATCCTTGTTTTGTTAAAGTTGCAAAACACTAT
TTATTAGAAACGTCTGTTAAAATTTGCACAGTTATTGGTTTTCCACTAGG
CGCTAACACAATTGAAACTAAAGTTTTTGAAACAAAAAACGCTATAGATT
TAGGTGCTGATGAAATTGATATGGTTATTAATATTAATCAATTAATCAAT
GGTAATAGAGAATATTGCTTAAATGAAATTAATCAAATTAAAGAAGTTTG
TGGGGATAAAATTTTAAAAGTGATCGTTGAAACAGCATTTTTGAACAGGG
AGCAAAAAGAATTTGCAGCTAAAATTATTCTAGAATCAAATGCTGATTTC
ATTAAAACATCAACTGGTTTTGCAAAAGAAGGTGCAAAACTTGAAGATAT
TATTCTATGAAAGCGAATTTTAGGTGATGTAAAACAAATTAAAGCATCAG
GTGGAATTAAAAATTTTGAGGATTTTAAATCTTTTATTGAAGCTGGAGCT
ACAAGGATCGGAACGTCATCAGCAATTAAAATATTAAATAATCACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy