Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR478 IGR479 IGR474 IGR481 IGR475 IGR480 IGR477 IGR476 IGR482 rpS16,rpsP, - UU568 rplS,rpL19, - UU566 UU563 trmD, - UU567 UU569 oppB, - UU562 UU564 UU565 UU570 UU571 UU563.1 rpS16,rpsP, - UU568 rplS,rpL19, - UU566 UU563 trmD, - UU567 UU569 oppB, - UU562 UU564 UU565 UU570 UU571 UU563.1 Type: tandem, Name:  - 348 Type: tandem, Name:  - 345 Type: tandem, Name:  - 350 Type: tandem, Name:  - 346 Type: tandem, Name:  - 347 Type: tandem, Name:  - 349 Type: tandem, Name:  - 351 rpS16,rpsP, - UU568 rplS,rpL19, - UU566 UU563 trmD, - UU567 UU569 oppB, - UU562 UU564 UU565 UU570 UU571 UU563.1
* Calculated from Protein Sequence

Gene ID: UU567

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trmD  

Definition:
tRNA (guanine-N1)-methyltransferase

Gene Start:
708593

Gene Stop:
707907

Gene Length:
687

Molecular Weight*:
26119

pI*:
7.30

Net Charge*:
0.68

EC:
2.1.1.31  

Functional Class:
translation; tRNA modification  

Pathway: pathway table

Comment:
One of several nucleases operating together with the tRNA-modifying enzymes leading to the formation of mature tRNA, this enzyme catalyzes the addition of N(1)-methylguanine to tRNA.

See UU402, a predicted trmU sequence.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to tRNA (guanine-N1)-methyltransferases; e.g. residues 1-227 are 51% similar to TRMD_MYCGE; residues 1-224 are 50% similar to TRMD_BORBU; and residues 1-223 are 44% similar to TRMD_SYNY3. Also similar to: TRMD_BACSU, TRMD_AQUAE, TRMD_HAEIN, TRMD_SERMA, TRMD_SALTY, TRMD_HELPY, and TRMD_ACICA.
BLAST also reveals similarity to MG445, CT027, and TP0908, all of which are predicted tRNA (guanine-N1)-methyltransferases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0336 is ehgpc--u.
Cog name: tRNA-(guanine-N1)-methyltransferase.
Functional class: J.
BeTs to -hg-c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 25-227 are 54% similar to a defined domain of TRMD_MYCGE.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 22 to 228 (E-value = 3.6e-104) place UU567 in the tRNA_m1G_MT family which is described as tRNA (Guanine-1)-methyltransferase (PF01746)

PDB Hit:


Gene Protein Sequence:
MKISILSLFPELYETWIKHSIISNAIKNNQVIIEVIDFRLYTNDKHKKVD
DYQYGGGAGMVLRIEPIVAAIRAIRSSNSYVILTTPKGQVFNQELANNFV
SKYDHIIIIAGHYEGFDERINYYIDAQYSIGDFVLTGGELPSMVISDAVI
RLLDGVISPSSLETESFNNYLLDYPVYTRPLVFEGHKVPDILLSGHHKNI
ADFRKQQQETITKKNRPDLYQKYLNNKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATATCGATTTTATCTTTATTTCCTGAATTATATGAAACATGGAT
AAAGCATTCAATTATTAGTAATGCTATTAAAAATAACCAAGTTATAATAG
AAGTTATCGATTTTCGTTTATATACAAATGATAAACATAAAAAAGTTGAT
GATTACCAATATGGTGGCGGAGCAGGTATGGTTTTAAGGATTGAACCAAT
TGTTGCTGCCATTCGTGCAATTCGTTCTTCTAATTCATATGTGATTTTAA
CAACACCAAAAGGTCAAGTTTTTAATCAAGAATTAGCAAACAATTTTGTT
AGTAAATATGATCATATCATCATTATTGCTGGTCATTATGAAGGTTTTGA
TGAACGTATTAATTATTACATTGACGCCCAATATAGTATCGGTGATTTTG
TCTTAACAGGGGGGGAATTACCAAGTATGGTAATTTCTGATGCTGTTATT
CGTTTGTTAGATGGCGTTATTTCTCCTTCTAGTTTAGAAACTGAATCATT
TAATAACTACTTATTAGATTATCCTGTTTACACACGCCCTCTTGTTTTTG
AAGGGCATAAAGTACCGGATATACTATTATCTGGTCATCATAAAAATATT
GCTGATTTTCGTAAACAGCAACAAGAGACGATTACTAAAAAGAATCGTCC
TGATTTATATCAAAAATATTTAAATAACAAAAAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy