Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR461 IGR462 IGR468 IGR464 IGR459 IGR460 IGR465 IGR463 IGR466 IGR467 rpsR,rpS18, - UU552 rplI,rpL9, - UU551 rpS6, - UU554 UU556 ssb, - UU553 UU547 gluA,gatA, - UU545 dnaB, - UU550 UU549 UU557 UU555 rpsR,rpS18, - UU552 rplI,rpL9, - UU551 rpS6, - UU554 UU556 ssb, - UU553 UU547 gluA,gatA, - UU545 dnaB, - UU550 UU549 UU557 UU555 Type: tandem, Name:  - 340 Type: tandem, Name:  - 424 Type: tandem, Name:  - 339 Type: tandem, Name:  - 343 Type: tandem, Name:  - 337 Type: tandem, Name:  - 388 Type: tandem, Name:  - 342 Type: tandem, Name:  - 338 Type: tandem, Name:  - 341 rpsR,rpS18, - UU552 rplI,rpL9, - UU551 rpS6, - UU554 ssb, - UU553 UU547 gluA,gatA, - UU545 dnaB, - UU550 UU549 UU557 UU546 ung, - UU548 UU546 ung, - UU548 UU556 UU555
* Calculated from Protein Sequence

Gene ID: UU550

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaB  

Definition:
replicative DNA helicase

Gene Start:
685887

Gene Stop:
684427

Gene Length:
1461

Molecular Weight*:
55919

pI*:
5.80

Net Charge*:
-3.37

EC:
3.6.1.-  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Comment:
In E.coli, the DNAB protein is involved in initiation and elongation
during chromosome replication. It is a homomeric enzyme.

The complete list of dna() genes in U.u. are: UU001, a predicted dnaA sequence; UU019, a predicted dnaH sequence; UU079, a predicted dnaN sequence; UU087, a predicted dnaX sequence; UU339, a predicted dnaK sequence; UU407, a predicted dnaJ sequence; UU415, a predicted dnaE sequence; UU494, a predicted dnaG sequence; and UU550, a predicted dnaB sequence.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to replicative DNA helicases; e.g. residues 45-479 are 30% similar to DNAB_MYCGE; residues 35-479 are 27% similar to DNAC_BACSU; and residues 87-478 are 30% similar to DNAB_ODOSI. Also similar to: DNAB_HAEIN, DNAB_HELPY, DNAB_ECOLI, DNAB_SALTY, DNAB_SYNY3, and DNAB_PORPU.
BLAST also reveals significant similarity to MG094, CT497, TP0058, and pCT01, all of which are predicted DNA helicases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0305 is ehgpc--u.
Cog name: Replicative DNA helicase.
Functional class: L.
BeTs to -hg-c--u.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 108-471 span seven regions of similarity to blocks PF00772A-F (DnaB-like helicase.)

ProDom Summary:  Protein Domain Search
Residues 183-415 are 35% similar to a defined domain of DNAB_MYCPN.

Paralogs:  Local Blast Search
UU263, a conserved hypothetical protein, is a possible paralog.

Pfam Summary:  Pfam Search
Residues 178 to 385 (E-value = 9.1e-44) place UU550 in the DnaB_C family which is described as DnaB-like helicase C terminal domain (PF03796)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
108
coil-coil  
109  
169
non-globular  
219  
282

PDB Hit:


Gene Protein Sequence:
MPTKDLNDAILDLFCLIINNNDFWKDVVLRLEVKDFPEKIQQNIFNTIAN
LNEQKYKINESNILNALANYVIIDEQDQNYLLHKNYLLQILDRTDYLVDL
KDCIEIIKNASIKNKLDVFANEILATQISLINAKDQFKEMHEKFLEILAS
RTEDTIENMELIANRYFEKLNKIGNSGIIPGVIKTKYDNIDKFTNGYKPG
ELVVIAARPGIGKTTFCLNVMVNNVNEIIEYNENIQPNQKEKIIVMFSLE
ITKEQILQKFISIKTGISNREVIENKYRITKGYDTRSFAMQAINDIKSWP
IFIDDRPNISIVDIEAKLYDLKKRYDIALVVLDYLQLVSGGNANKNMTRT
QEVGRVSSALKIIAKEINAPVIAIAQLSRKAEERDVSNNVNMKNNPLVKT
IDNSPKLSDLRESGSIEQDADVVAFLHWDRKQRNFMQNDNQETRMRDDLI
EAKFIVEKNRNGSTGETDIIFSKLNSKFIRATTSKE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAACAAAAGACTTAAATGATGCGATATTAGATTTGTTTTGTTTAAT
TATTAATAATAATGACTTTTGAAAAGATGTTGTTTTACGTTTAGAAGTTA
AAGATTTTCCAGAAAAGATTCAGCAAAATATTTTTAATACAATTGCTAAT
TTAAACGAACAAAAGTATAAAATCAATGAATCAAATATTTTAAATGCATT
AGCTAATTATGTGATTATTGATGAACAAGATCAAAATTATTTATTACATA
AGAATTATTTACTTCAAATTTTAGATCGTACTGATTATTTAGTAGATTTA
AAAGATTGTATTGAAATTATTAAGAATGCTTCAATTAAAAATAAACTTGA
TGTTTTTGCAAATGAGATTTTAGCAACCCAAATTTCATTAATTAACGCTA
AAGATCAATTTAAAGAAATGCATGAAAAATTTTTAGAAATTCTTGCATCA
CGAACCGAAGATACTATTGAAAATATGGAATTAATTGCTAATCGATATTT
TGAGAAATTAAATAAAATAGGCAATAGCGGGATTATTCCTGGAGTTATTA
AAACTAAATACGATAATATTGATAAATTCACTAATGGTTATAAACCTGGA
GAATTAGTTGTTATTGCCGCTCGTCCTGGAATTGGAAAAACTACATTTTG
TTTAAATGTTATGGTTAACAATGTTAATGAAATTATTGAATATAACGAAA
ATATTCAACCAAATCAAAAAGAAAAGATCATTGTAATGTTTTCGCTTGAA
ATTACTAAAGAACAAATTTTACAAAAGTTTATCTCAATTAAAACAGGAAT
TTCTAATCGTGAAGTTATAGAAAATAAATATCGTATAACTAAAGGATATG
ACACAAGGTCTTTTGCTATGCAAGCAATCAATGATATTAAAAGTTGACCT
ATTTTTATCGATGATCGTCCTAATATTTCAATTGTAGACATTGAAGCAAA
ATTATATGATTTAAAAAAACGTTATGATATTGCTTTAGTCGTTTTAGATT
ATTTACAATTGGTTTCAGGAGGCAATGCAAATAAAAATATGACAAGAACA
CAAGAGGTAGGTCGTGTTTCAAGTGCATTAAAAATCATTGCTAAAGAAAT
TAATGCACCAGTAATCGCTATCGCTCAACTTTCACGTAAAGCAGAAGAAC
GTGATGTAAGCAATAATGTTAATATGAAAAATAACCCTTTAGTAAAAACA
ATTGATAATTCCCCAAAATTGTCTGATTTGCGAGAATCTGGATCAATTGA
ACAAGATGCTGACGTTGTTGCTTTTTTACATTGGGATCGAAAACAACGCA
ATTTTATGCAAAATGATAATCAAGAAACCCGAATGCGCGATGATTTGATT
GAAGCAAAATTTATTGTTGAAAAGAACCGAAACGGGTCAACAGGTGAAAC
TGATATTATTTTTTCTAAATTAAATAGTAAATTTATTCGTGCAACCACTT
CAAAGGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy