Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR461 IGR458 IGR462 IGR464 IGR459 IGR460 IGR465 IGR457 IGR463 rpsR,rpS18, - UU552 rplI,rpL9, - UU551 rpS6, - UU554 ssb, - UU553 UU547 gatB,pet112, - UU544 gluA,gatA, - UU545 dnaB, - UU550 UU549 UU543 rpsR,rpS18, - UU552 rplI,rpL9, - UU551 rpS6, - UU554 ssb, - UU553 UU547 gatB,pet112, - UU544 gluA,gatA, - UU545 dnaB, - UU550 UU549 UU543 Type: tandem, Name:  - 337 Type: tandem, Name:  - 342 Type: tandem, Name:  - 336 Type: tandem, Name:  - 340 Type: tandem, Name:  - 334 Type: tandem, Name:  - 341 Type: tandem, Name:  - 339 Type: tandem, Name:  - 335 Type: tandem, Name:  - 338 rpsR,rpS18, - UU552 rplI,rpL9, - UU551 ssb, - UU553 UU547 gatB,pet112, - UU544 gluA,gatA, - UU545 dnaB, - UU550 UU549 UU546 ung, - UU548 UU546 ung, - UU548 rpS6, - UU554 UU543
* Calculated from Protein Sequence

Gene ID: UU548

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ung  

Definition:
Uracil-DNA N-glycosylase

Gene Start:
682679

Gene Stop:
682041

Gene Length:
639

Molecular Weight*:
24792

pI*:
10.20

Net Charge*:
13.91

EC:
3.2.2.-  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
See Prosite PDOC00121.

From Prosite:

Uracil-DNA glycosylase (EC 3.2.2.-) (UNG) [1] is a DNA repair enzyme that
excises uracil residues from DNA by cleaving the N-glycosylic bond. Uracil in
DNA can arise as a result of misincorportation of dUMP residues by DNA
polymerase or deamination of cytosine.

The sequence of uracil-DNA glycosylase is extremely well conserved [2] in
bacteria and eukaryotes as well as in herpes viruses. More distantly related
uracil-DNA glycosylases are also found in poxviruses [3].

[ 1] Sancar A., Sancar G.B.
Annu. Rev. Biochem. 57:29-67(1988).
[ 2] Olsen L.C., Aasland R., Wittwer C.U., Krokan H.E., Helland D.E.
EMBO J. 8:3121-3125 (1989).
[ 3] Upton C., Stuart D.T., McFadden G.
Proc. Natl. Acad. Sci. U.S.A. 90:4518-4522(1993).


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to uracil-DNA glycosylases; e.g. residues 3-212 are 42% similar to UNG_MOUSE; residues 3-212 are 40% similar to UNG_HUMAN, and residues 3-212 are 38% similar to UNG_HAEIN. Also similar to: UNG_ECOLI, UNG_PSEDE, UNG_DICDI, UNG_BACSU, and UNG_YEAST.
BLAST also reveals similarity to CT607 and MG097, both of which are uracil DNA glycosylases. No significant similarity to T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0692 is ehgp--yu.
Cog name: Uracil DNA glycosylase.
Functional class: L.
BeTs to -h-p--yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 3-186 span five regions of similarity to blocks BL00130A-E (Uracil-DNA glycosylase proteins.)

ProDom Summary:  Protein Domain Search
Residues 15-212 are 47% similar to a defined domain of UNG_MOUSE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 46 to 203 (E-value = 2.4e-47) place UU548 in the UDG family which is described as Uracil DNA glycosylase superfamily (PF03167)

PDB Hit:
gi|2392165|pdb|1AKZ| Human Uracil-Dna Glycosylase

Gene Protein Sequence:
MKWKEFIINETKQSYLKNIIKKINNIENHQVVFPLKKQRFRCFDFFDIEQ
TKVVILGQDPYHTPKIANGLCFSVDLGNNLPGSLINIFKALEYDLQIKRT
NPDLSDWAKQGVLLLNTVLTVNAHQPNSHKNFGYEELIKNVFNELRKQKH
VVYLLWGKQAMSYINLIDQKQNLILCASHPSPLSAHRGFLTCKHFSKCND
YLIKHLRTPIKW$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATGAAAAGAATTCATAATTAATGAAACTAAACAAAGTTATTTAAA
AAATATTATTAAAAAAATCAACAACATCGAGAATCATCAAGTAGTTTTTC
CTTTAAAAAAACAACGGTTTAGATGTTTTGATTTTTTTGATATTGAACAA
ACTAAAGTTGTTATTTTAGGGCAAGATCCATACCATACACCTAAAATAGC
TAATGGTTTGTGTTTTAGTGTGGATTTAGGAAATAATTTACCAGGATCAC
TAATCAATATTTTTAAAGCTTTAGAATATGATTTACAAATAAAAAGAACA
AACCCTGATTTGTCTGATTGGGCAAAACAAGGAGTTTTATTGTTGAATAC
TGTTTTAACTGTTAACGCTCATCAACCAAATTCGCATAAAAATTTTGGTT
ATGAAGAATTAATTAAAAATGTGTTTAACGAACTTAGAAAACAAAAGCAT
GTTGTTTATTTATTATGAGGAAAACAAGCTATGAGTTACATTAATTTGAT
TGATCAAAAACAAAATTTAATTTTATGTGCTTCACATCCTTCGCCATTAA
GTGCACATCGTGGTTTTTTAACTTGTAAACATTTTAGTAAATGCAATGAT
TATTTAATTAAACATTTACGCACTCCAATAAAATGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy