Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR461 IGR458 IGR462 IGR459 IGR460 IGR457 IGR463 rpsR,rpS18, - UU552 rplI,rpL9, - UU551 UU547 gluA,gatA, - UU545 gatB,pet112, - UU544 dnaB, - UU550 UU549 UU543 rpsR,rpS18, - UU552 rplI,rpL9, - UU551 UU547 gluA,gatA, - UU545 gatB,pet112, - UU544 dnaB, - UU550 UU549 UU543 Type: tandem, Name:  - 337 Type: tandem, Name:  - 342 Type: tandem, Name:  - 336 Type: tandem, Name:  - 340 Type: tandem, Name:  - 334 Type: tandem, Name:  - 341 Type: tandem, Name:  - 339 Type: tandem, Name:  - 335 Type: tandem, Name:  - 338 rplI,rpL9, - UU551 UU547 gluA,gatA, - UU545 gatB,pet112, - UU544 dnaB, - UU550 UU549 UU546 ung, - UU548 UU546 ung, - UU548 rpsR,rpS18, - UU552 UU543
* Calculated from Protein Sequence

Gene ID: UU547

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible glu-tRNA amidotransferase, subunit C)

Gene Start:
682002

Gene Stop:
680986

Gene Length:
1017

Molecular Weight*:
37737

pI*:
10.60

Net Charge*:
13.95

EC:
6.3.5.-  

Functional Class:
unknown  

Pathway: pathway table
Alanine and Aspartate metabolism
Glutamate metabolism

Comment:
Notice high A+T content at 5' and 3' ends of cds.

Disruption of glu-tRNA amidotransferase operon is lethal. This demonstrates that
transamidation is the only pathway to Gln-tRNA in B. subtilis and
that glutamyl-tRNA amidotransferase is a novel and essential
component of the translational apparatus.

See UU544 for subunit B and UU545 for subunit A.

Blast Summary:  PSI-Blast Search
Weak hits in gapped BLAST to hypothetical protein MG098 homologs Y098_MYCPN and Y098_MYCGE:
residues 8-319 are 29% similar to MG098.
No significant similarities to C.trachomatis or T.pallidum.

COGS Summary:  COGS Search
No COG found in manual search. The following found automatically:

The phylogenetic pattern of COG0721J is EhGPcMYu.
Cog name: (Predicted) amino acid permeases.
Functional class: E.
BeTs to ---p----.
Number of proteins in this genome belonging to this COG is 3



Blocks Summary:  Blocks Search
Residues 212-233, 109-130, 140-161, 14-37, 28-51, 20-44, and 172-193 are ing the 97.11th percentile of similarity to blocks PR00250A,C,E,G (FUNGAL PHEROMONE MATING FACTOR STE2 GPCR SIGNATURE)

ProDom Summary:  Protein Domain Search
Residues 24-242 are 33% similar, and residues 247-319 are 32% similar to a defined domain of Y098_MYCPN, a protein MG098 transmembrane homolog.

Paralogs:  Local Blast Search
UU330, a conserved hypothetical protein, is a possible paralog.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
19  
45
transmembrane  
57  
91
transmembrane  
100  
127
transmembrane  
131  
158
transmembrane  
170  
195
transmembrane  
203  
236
transmembrane  
251  
275
transmembrane  
287  
319

PDB Hit:


Gene Protein Sequence:
MSVLHTTNTSQGNGINSWQSILIFLAFLIVFIIFTVIKKIYYSIRFQKRF
YIIPKTSVKGISNIAMVISISVAVIILLTVLSANTASVIFRAWPGTRVTL
EGILIKIGGLLFGPILGIFIGAMTDLLSVAMTAGVFHYGYLIAAMAYGLI
GGLIRIILTTSKKKDLPFAIYSSMATILIGVGIALFLYFAPGIGDKGFNI
QLFGFDIKIARTLMIGIILGFFLLSIIVVWFSLLIKYWFNKKNKAKTKTN
WFIIFAPVLVTILLTEAVVNVLMMPSFDAELSSLKYTQWLSIRAVLFIPM
VVLNLLIIYPIFKIVVPLIRYDYEDDIVEDKHIPIHVD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGTATTACATACAACTAATACTTCACAAGGTAATGGAATTAATTC
ATGACAATCAATTTTAATTTTTTTAGCATTTTTGATTGTTTTTATTATCT
TTACAGTTATTAAAAAAATCTATTATTCAATTCGTTTTCAAAAGCGTTTT
TATATTATTCCTAAAACTTCGGTTAAAGGGATTTCAAATATTGCTATGGT
GATTTCGATTTCTGTTGCAGTGATTATATTATTAACAGTTTTATCAGCTA
ACACAGCTTCTGTAATTTTTCGTGCTTGACCAGGTACACGTGTTACTTTA
GAAGGGATTCTTATTAAAATTGGAGGTTTATTATTTGGTCCAATTTTAGG
TATTTTTATTGGTGCAATGACTGATTTATTATCTGTGGCTATGACTGCTG
GTGTATTTCATTATGGTTATTTAATTGCTGCTATGGCTTATGGATTAATT
GGAGGACTAATTCGAATTATTCTAACTACTTCCAAAAAAAAGGATTTACC
ATTTGCAATTTATAGTTCAATGGCAACTATTTTAATTGGTGTAGGAATTG
CCTTATTTTTATATTTTGCTCCAGGAATTGGTGATAAGGGTTTTAATATT
CAATTATTTGGTTTTGATATTAAAATTGCACGAACATTGATGATTGGCAT
TATTTTAGGTTTTTTCTTATTATCAATTATCGTTGTTTGGTTTAGTTTAT
TGATAAAATATTGATTCAATAAAAAAAATAAAGCTAAAACCAAAACAAAT
TGATTCATTATATTTGCCCCTGTTTTAGTAACAATTTTACTAACTGAAGC
AGTGGTTAATGTACTAATGATGCCATCGTTTGATGCTGAATTATCAAGTC
TAAAATATACACAATGATTATCAATTCGTGCTGTTTTATTTATTCCAATG
GTGGTTTTAAACTTATTGATTATTTATCCAATTTTTAAAATTGTTGTTCC
TTTAATTCGTTATGATTATGAAGATGATATTGTTGAGGATAAACATATTC
CAATTCATGTTGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy