Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR461 IGR458 IGR459 IGR460 IGR457 UU547 gluA,gatA, - UU545 gatB,pet112, - UU544 dnaB, - UU550 UU549 UU543 UU547 gluA,gatA, - UU545 gatB,pet112, - UU544 dnaB, - UU550 UU549 UU543 Type: tandem, Name:  - 337 Type: tandem, Name:  - 334 Type: tandem, Name:  - 339 Type: tandem, Name:  - 335 Type: tandem, Name:  - 336 Type: tandem, Name:  - 338 UU547 gluA,gatA, - UU545 gatB,pet112, - UU544 dnaB, - UU550 UU549 UU546 ung, - UU548 UU546 ung, - UU548 UU543
* Calculated from Protein Sequence

Gene ID: UU545

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gluA  gatA  

Definition:
amidase (glu-tRNA amidotransferase, subunit A)

Gene Start:
680691

Gene Stop:
679258

Gene Length:
1434

Molecular Weight*:
53239

pI*:
8.30

Net Charge*:
2.65

EC:
3.5.1.4  

Functional Class:
translation; tRNA modification  

Pathway: pathway table
Arginine and proline metabolism
Benzoate degradation via CoA ligation
Cyanoamino acid metabolism
Phenylalanine metabolism
Styrene degradation
Tryptophan metabolism

Comment:
Reaction for amidase:
A MONOCARBOXYLIC ACID AMIDE + H(2)O = A MONOCARBOXYLATE + NH(3).

Disruption of this operon is lethal. This demonstrates that
transamidation is the only pathway to Gln-tRNA in B. subtilis and
that glutamyl-tRNA amidotransferase is a novel and essential
component of the translational apparatus.

See UU544 for subunit B and UU547 for possible subunit C.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glu-tRNA amidotransferase subunit A; e.g. residues 1-438 are 29% similar to (AE001275) from C.trachomatis; residues 4-477 are 28% similar to (AE000680) of Aquifex aeolicus; and residues 6-426 are 31% similar to (AF008553) of B.subtilis.
BLAST also reveals significant similarity to MG099, CT003, and TP1020, all of which are amidase/ glu-tRNA amidotransferase, subunit A sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0154 is --gpCmYu.
Cog name: Glu-tRNAGln amidotransferase A subunit (amidase).
Functional class: J.
BeTs to --g-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 141-192 represent block BL00571 (Amidases proteins.)
Residues 17-44, 121-157, 417-453, and 419-428 are in the 95.17th percentile of similarity to blocks BL01175A-C (Ribonuclease II family proteins.)

ProDom Summary:  Protein Domain Search
Residues 69-238 are 62% similar, and residues 256-471 are 39% similar to a defined domain of AMID_MYCGE; residues 75-240 are 52% similar to a defined domain of AMDZ_YEAST.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 22 to 462 (E-value = 1e-86) place UU545 in the Amidase family which is described as Amidase (PF01425)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
38  
65
non-globular  
440  
477

PDB Hit:


Gene Protein Sequence:
MKNKTILALHNQIKKREVKIYDLIKKSIDHDLKIKNLNATLANNYEQALK
QAAFLDEKISSDNLEIDYLFGIPYSLKDNISTKNIITTGGSLFLKNYNPP
YDATVKTLLDQKQAILLNKSNLDEFGLGGTGTDSAFGPVINPLNPKHVSG
GSSSGSAVLVQQGVVPFAIATDTGDSVRRPASIMGIVGFKPSYGLISRYG
VYPFAPSLDHVGIFTNNIFDTQIVFNALAKRDFKDFTSLSFKTQSLSMLK
TKNKYKIGVLKPSFDLLASKYQQELTNLIVKLNDEHEIINVDYDINLLKA
ISPVYKLIAFSEAYSSYSNFTNITFGKHDIDYDNYEDLIIKTRTLYLGTQ
LKQRFMIGAYVTQESQFETLLVAAKKMRTLIVDQAKNLFKNCDLILNLAV
HDISETIDDVNNQKPTTNLVEDVMQIANFGGFPSIVIPFLTTKLGNLGLN
LWADYLNDNKLLNGAYLINNLLGNEEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAATAAAACTATTTTAGCGCTTCATAATCAAATTAAAAAACGTGA
AGTTAAAATTTATGATTTGATTAAAAAATCGATTGATCATGATTTAAAGA
TTAAAAATTTAAATGCAACTTTAGCAAATAATTATGAACAGGCATTGAAA
CAAGCAGCTTTTTTAGATGAAAAGATTAGTAGTGATAATTTAGAAATTGA
TTATTTATTTGGAATTCCATATTCTTTAAAAGACAACATTTCAACTAAGA
ATATTATTACAACAGGTGGTTCATTGTTTTTAAAAAATTACAATCCTCCA
TATGATGCGACAGTTAAAACATTATTAGATCAAAAACAAGCAATTTTGTT
AAATAAATCAAATTTAGATGAATTTGGTTTAGGAGGCACTGGTACTGATT
CAGCATTTGGCCCTGTAATTAATCCATTAAATCCAAAACATGTTAGCGGA
GGTTCTTCATCTGGTAGTGCTGTTTTAGTTCAACAAGGCGTTGTACCTTT
TGCAATTGCTACAGATACAGGAGATTCTGTTCGTCGCCCCGCTTCAATTA
TGGGTATTGTTGGTTTTAAACCGTCATATGGTCTTATTTCGCGTTATGGC
GTTTACCCCTTTGCTCCTTCTCTTGATCATGTTGGAATTTTTACAAATAA
TATTTTTGATACGCAAATTGTTTTTAATGCTCTTGCTAAGCGAGATTTTA
AAGATTTTACAAGTCTTAGTTTTAAAACACAATCACTTTCAATGCTAAAA
ACAAAAAATAAATATAAGATTGGTGTTTTAAAACCTAGTTTTGATTTATT
AGCATCAAAATATCAACAAGAATTAACTAATCTGATTGTTAAATTAAATG
ATGAGCATGAAATAATTAATGTTGATTATGATATTAATTTATTAAAGGCA
ATTAGTCCAGTTTATAAATTAATCGCTTTTAGTGAGGCTTATAGTTCATA
CTCTAATTTTACAAACATCACTTTTGGCAAACATGATATTGATTATGATA
ACTATGAGGATTTAATTATTAAAACGCGAACTTTATATTTAGGAACACAA
TTAAAACAACGTTTTATGATAGGTGCTTATGTTACTCAAGAAAGCCAGTT
TGAAACTTTATTAGTTGCTGCTAAAAAAATGCGTACATTAATAGTTGATC
AAGCTAAAAATTTATTTAAAAATTGTGATTTAATTTTAAATTTAGCAGTT
CATGATATAAGTGAAACAATTGATGATGTTAACAACCAAAAGCCCACAAC
TAATTTAGTTGAAGATGTAATGCAAATTGCTAATTTTGGTGGTTTTCCAT
CAATTGTAATCCCCTTTTTAACAACTAAATTAGGAAATTTAGGTTTAAAT
TTGTGAGCAGATTACTTAAATGATAATAAATTATTAAATGGCGCTTATTT
AATCAATAATTTACTAGGAAATGAGGAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy