Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR458 IGR459 IGR460 IGR457 UU547 gluA,gatA, - UU545 gatB,pet112, - UU544 UU549 UU543 UU547 gluA,gatA, - UU545 gatB,pet112, - UU544 UU549 UU543 Type: tandem, Name:  - 336 Type: tandem, Name:  - 333 Type: tandem, Name:  - 338 Type: tandem, Name:  - 334 Type: tandem, Name:  - 335 Type: tandem, Name:  - 337 UU547 gluA,gatA, - UU545 gatB,pet112, - UU544 UU549 UU546 ung, - UU548 UU546 ung, - UU548 UU543
* Calculated from Protein Sequence

Gene ID: UU544

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gatB  pet112  

Definition:
GlutRNA-Gln amidotransferase B subunit/ PET112 homolog

Gene Start:
679255

Gene Stop:
677822

Gene Length:
1434

Molecular Weight*:
55268

pI*:
9.60

Net Charge*:
8.11

EC:
6.3.5.-  

Functional Class:
translation; tRNA modification  

Pathway: pathway table
Alanine and Aspartate metabolism
Glutamate metabolism

Comment:

See Prosite PDOC00948.

Disruption of this operon is lethal. This demonstrates that
transamidation is the only pathway to Gln-tRNA in B. subtilis and
that glutamyl-tRNA amidotransferase is a novel and essential
component of the translational apparatus.

See UU545 for subunit A, and UU547 for possible subunit C.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to amidotransferases and PET112-like proteins; e.g. residues 2-477 are 34% similar to (AE000691) glutamyl-tRNA (Gln) amidotransferase subunit B of Aquifex aeolicus; residues 4-472 are 34% similar to (AJ235270) GLUTAMYL-tRNA AMIDOTRANSFERASE SUBUNIT B (gatB) of Rickettsia prowazekii.
BLAST also reveals significant similarity to MG100, TP1021, and CT004, all of which are predicted Glu-tRNAGln amidotransferase B subunit/ PET112 homolog sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0064 is --gpcMyu.
Cog name: Glu-tRNAGln amidotransferase B subunit (PET112 homolog).
Functional class: J.
BeTs to ---pcmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 78-417 span six regions of similarity to blocks BL01234A-E (PET112 family proteins.)

ProDom Summary:  Protein Domain Search
Residues 63-474 are 42% similar, and residues 9-59 are 57% similar to Y100_MYCPN, a PET112-like protein.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 2 to 241 (E-value = 3.2e-115) place UU544 in the GatB_N family which is described as PET112 family, N terminal region (PF02934)
Residues 330 to 475 (E-value = 2.3e-14) place UU544 in the GatB_Yqey family which is described as GatB/Yqey domain (PF02637)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
353  
440

PDB Hit:


Gene Protein Sequence:
MQNFEVIIGIEVHTALNTKTKMFSNAATSHKSIPNTLINEIDLALPGTLP
TVNQEVVHKGLFLANALHMRTNHQFIAFDRKHYYYLDLPKGYQITQNYFP
IGQNGYIQIIDEYNNLKRIRIKQIHLEEDTAKQTNIGNQIYLDYNRAGWP
LIEIVSEADLRSAQETVLFLEELRKILLFNDISDAKMEDGSLRVDVNVSI
RPQGAKKFGTKVEIKNINSISNVAKAIDYEIRRQLNLILLNQNVEQQTRR
FDDNTNTTVFMRSKNDAINYRYIREANIAPIHLSDDYVKKMFLTKSCSIN
DLRQQLAQKGLVSSAIEQLLSDGPLFKAFKYVDKIVNNPLSVYKWLCLEF
IGLINKNTQNIEEITPELLQKIARMILLFDQTLINGKQTKIILEKIYLTN
KDPQILIKELGFEQITNENEITKLWHQILAKNQEMLLQYNERPDRVEKFF
MGEIMKLTKAQANPTISFNVLKKILQK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAATTTTGAAGTTATTATTGGTATTGAAGTGCATACTGCACTTAA
TACAAAAACCAAAATGTTTTCTAATGCAGCAACATCGCATAAGAGTATTC
CTAACACTTTAATTAATGAAATTGATTTAGCATTGCCAGGTACATTACCA
ACTGTTAATCAAGAAGTTGTTCATAAAGGACTTTTTTTAGCAAATGCATT
ACACATGCGTACTAATCATCAATTTATTGCTTTTGATCGTAAGCATTATT
ATTATTTAGACTTACCTAAAGGATATCAAATTACACAAAATTATTTTCCA
ATAGGTCAGAATGGTTATATTCAAATCATTGATGAATATAATAATTTAAA
ACGAATACGTATCAAACAAATTCATTTAGAAGAAGATACAGCCAAACAAA
CTAATATAGGTAATCAAATATATTTAGATTATAACCGTGCAGGATGACCT
TTAATTGAAATCGTTAGTGAAGCAGATTTACGAAGTGCACAAGAGACGGT
TTTATTTTTAGAAGAATTGCGAAAAATTTTATTGTTTAATGATATATCAG
ATGCAAAAATGGAAGATGGATCATTACGTGTTGATGTAAACGTTTCAATT
AGACCTCAAGGGGCTAAAAAATTTGGCACAAAAGTAGAAATTAAAAATAT
TAATTCTATTTCAAATGTTGCTAAAGCTATTGATTATGAGATAAGACGTC
AATTAAATTTAATTTTACTAAATCAGAATGTTGAACAACAAACACGACGT
TTTGATGATAATACGAATACAACGGTTTTTATGCGTTCAAAAAATGATGC
TATTAATTATCGCTATATTCGTGAAGCAAATATTGCACCAATTCATCTAA
GTGATGATTATGTAAAAAAAATGTTTTTAACTAAATCATGTAGTATTAAT
GATTTGCGTCAACAACTAGCACAAAAAGGTTTAGTTAGTTCTGCTATCGA
ACAGTTATTAAGTGATGGACCGTTGTTTAAAGCATTTAAATATGTAGACA
AAATTGTTAATAATCCTTTAAGTGTTTATAAATGATTATGTTTGGAATTT
ATTGGTCTAATTAATAAAAATACGCAAAACATTGAAGAAATTACACCAGA
ATTATTGCAAAAAATTGCTAGAATGATCTTATTATTTGATCAAACTTTGA
TTAATGGAAAACAAACAAAAATAATTTTAGAAAAAATTTATTTGACAAAT
AAAGATCCTCAAATTCTAATTAAGGAATTAGGTTTTGAGCAAATTACTAA
TGAAAATGAAATTACTAAACTTTGACATCAAATTTTAGCTAAGAATCAAG
AAATGTTATTACAATACAATGAACGCCCCGACCGTGTTGAAAAATTTTTT
ATGGGTGAAATAATGAAATTAACTAAAGCACAAGCGAATCCAACCATTTC
TTTTAATGTTTTAAAAAAAATCTTACAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy