Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Trp-2 IGR454 IGR448 IGR449 IGR451 IGR453 IGR450 IGR447 rpL33,rpmG, - UU533 cdd, - UU531 rpL11,rplK, - UU541 rplA,rpL1, - UU540 truA,hisT, - UU536 pepP,ampP, - UU532 ABC, - UU538 UU537 thrS,syt, - UU534 UU535 rpL33,rpmG, - UU533 cdd, - UU531 rpL11,rplK, - UU541 rplA,rpL1, - UU540 truA,hisT, - UU536 pepP,ampP, - UU532 ABC, - UU538 UU537 thrS,syt, - UU534 UU535 Type: tandem, Name:  - 327 Type: tandem, Name:  - 326 Type: tandem, Name:  - 330 Type: tandem, Name:  - 324 Type: tandem, Name:  - 331 Type: tandem, Name:  - 329 Type: tandem, Name:  - 325 Type: tandem, Name:  - 328 rpL33,rpmG, - UU533 cdd, - UU531 rplA,rpL1, - UU540 truA,hisT, - UU536 pepP,ampP, - UU532 ABC, - UU538 UU537 thrS,syt, - UU534 ABC, - UU539 ABC, - UU539 rpL11,rplK, - UU541 UU535
* Calculated from Protein Sequence

Gene ID: UU536

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
truA  hisT  

Definition:
tRNA pseudouridine synthase A (tRNA pseudouridine synthase I)

Gene Start:
665867

Gene Stop:
665142

Gene Length:
726

Molecular Weight*:
28184

pI*:
9.90

Net Charge*:
9.54

EC:
4.2.1.70  5.4.99.12  

Functional Class:
translation; tRNA modification  

Pathway: pathway table
Pyrimidine metabolism

Comment:
This protein is involved in the formation of pseudouridine in the
anticodon stem and loop of tRNAs.

See UU113, UU313, and UU354 for other pseudouridine synthase sequences in U.u.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to tRNA pseudouridylate synthase A sequences; e.g. residues 9-241 are 38% similar to TRUA_MYCGE; residues 1-241 are 34% similar to TRUA_BACSU; and residues 7-241 are 33% similar to TRUA_BORBU. Also significant similarities to: TRUA_ECOLI, TRUA_HELPY, TRUA_PYRHO, TRUA_HAEIN, TRUA_ARCFU, TRUA_MYCTU, TRUA_METJA, and PUS2_YEAST.
BLAST reveals significant similarity to CT463 and TP0830, both of which are predicted pseudouridylate synthetases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0101 is ehgpcmYu.
Cog name: Pseudourydilate synthase I (tRNA psi55).
Functional class: J.
BeTs to e-g-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 9-21, 48-60, 81-115, and 147-156 are in the 100th percentile of similarity to blocks PD02906A-D (SYNTHASE I PSEUDOURIDYLATE PSEUDOURIDINE LYASE TR.)

ProDom Summary:  Protein Domain Search
Residues 9-239 are 38% similar to a defined domain of TRUA_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 5 to 105 (E-value = 1.9e-28) place UU536 in the PseudoU_synth_1 family which is described as tRNA pseudouridine synthase (PF01416)
Residues 143 to 241 (E-value = 6.4e-20) place UU536 in the PseudoU_synth_1 family which is described as tRNA pseudouridine synthase (PF01416)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
179  
211

PDB Hit:


Gene Protein Sequence:
MNYKISLRYDGSLFYGWARQPQKRTVQGDLEEIFKSIFKINNIRIIGSGR
TDKGVHAYEQTFSVKHSALKYDSHIIYQALCSRTSSDIQILEVQKVDDSF
HAQYNATSKTYQYVINDYEFDLFRNNYELFVNQKINDQKILEALELFVGE
HDFKSFSTSELTMTIRRINWVKIKRDTHLIIYINANGFLKNMVRMIVASC
LDYAFNKISLAKIHELLIYPKKGASIKLAPACGLYLYKVYY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTATAAAATTAGTCTTCGTTATGATGGTAGTTTATTTTATGGATG
AGCTAGACAACCACAAAAAAGAACGGTTCAAGGGGATTTAGAAGAAATTT
TTAAATCAATTTTTAAAATTAATAATATCAGGATTATTGGTTCAGGACGT
ACTGATAAAGGTGTACACGCTTACGAGCAAACCTTTAGTGTTAAACATAG
TGCGTTAAAATATGATTCGCACATTATTTATCAAGCACTTTGCTCACGAA
CTAGTTCTGATATTCAAATTTTAGAAGTGCAAAAGGTTGATGATTCATTT
CATGCTCAATATAATGCTACTTCTAAAACATATCAATATGTCATTAATGA
TTATGAATTTGATTTGTTTAGAAATAATTATGAACTTTTTGTTAATCAAA
AAATTAATGATCAAAAAATATTAGAAGCATTAGAATTGTTTGTTGGCGAA
CATGATTTTAAATCGTTTTCAACTAGTGAATTAACAATGACAATACGTCG
CATTAATTGAGTTAAAATCAAAAGAGATACACACTTAATAATTTATATTA
ATGCAAATGGTTTTTTAAAAAACATGGTTCGTATGATCGTTGCTTCTTGT
TTAGATTATGCTTTTAATAAAATAAGTTTAGCAAAAATTCATGAATTATT
AATATACCCCAAAAAGGGTGCTAGTATTAAATTAGCACCCGCTTGTGGAT
TATATTTGTATAAAGTCTATTATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy