Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Trp-2 IGR448 IGR446 IGR449 IGR451 IGR445 IGR450 IGR447 IGR444 rpL33,rpmG, - UU533 cdd, - UU531 truA,hisT, - UU536 pepP,ampP, - UU532 dcm, - UU528 UU537 manB,cpsG, - UU530 thrS,syt, - UU534 codV, - UU529 UU535 rpL33,rpmG, - UU533 cdd, - UU531 truA,hisT, - UU536 pepP,ampP, - UU532 dcm, - UU528 UU537 manB,cpsG, - UU530 thrS,syt, - UU534 codV, - UU529 UU535 Type: tandem, Name:  - 324 Type: tandem, Name:  - 325 Type: tandem, Name:  - 326 rpL33,rpmG, - UU533 cdd, - UU531 truA,hisT, - UU536 pepP,ampP, - UU532 dcm, - UU528 UU537 manB,cpsG, - UU530 thrS,syt, - UU534 codV, - UU529 UU535
* Calculated from Protein Sequence

Gene ID: UU532

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pepP  ampP  

Definition:
XAA-pro aminopeptidase

Gene Start:
662121

Gene Stop:
661048

Gene Length:
1074

Molecular Weight*:
39401

pI*:
6.10

Net Charge*:
-5.00

EC:
3.4.11.9  

Functional Class:
translation; degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:
This enzyme releases amino acids N-terminal to proline.

See UU065, a predicted pepF sequence; UU507, a predicted pepA sequence; and UU521, a predicted pepF sequence.

See Prosite PDOC00417 and PDOC00575.

Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to XAA-PRO aminopeptidases; e.g. residues 5-353 are 36% similar to AMPP_MYCGE; residues 20-352 are 34% similar to YQHT_BACSU; and residues 7-353 are 30% similar to 3372642 (AF060010), a proline dipeptidase of Pyrococcus furiosus.
BLAST reveals similarity to CT574, a probably XAA-pro aminopeptidase,
to TP0842, CT851, and MG172, all of which are predicted methionine aminopeptidases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0006 is EhgpcmYu.
Cog name: Xaa-Pro aminopeptidase.
Functional class: E.
BeTs to e--pcmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 191-202, 291-303, 315-329, and 334-347 are in the 100th percentile of similarity to blocks BL00491A-D (Aminopeptidase P and proline dipeptidase proteins.)
Residues 198-221 are in the 99.15th percentile of similarity to block PR00865E (PAPILLOMAVIRUS MAJOR CAPSID PROTEIN L1 SIGNATURE)

ProDom Summary:  Protein Domain Search
Residues 139-280 are 43% similar to a defined domain of AMPP_MYCGE.
Residues 285-345 are 62% similar to a defined domain of AMPP_MYCPN.
Residues 6-109 are 34% similar to a defined domain of AMPP_MYCGE.

Paralogs:  Local Blast Search
UU252, a methionine aminopeptidase (map), is a possible paralog in U.u.

Pfam Summary:  Pfam Search
Residues 290 to 351 (E-value = 2.7e-15) place UU532 in the Peptidase_M24 family which is described as metallopeptidase family M24 (PF00557)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
292  
357

PDB Hit:
gi|4699533|pdb|1JAW| Aminopeptidase P From E. Coli Low Ph Form

Gene Protein Sequence:
MSDFKLQQVLKTIKEHEAQGADGMILFSNYNRYWFLEFASSDGFVFINKD
GKAIYLVDARYYTAASETVKNAKVILLARTPQKSTFDLLKDAMVELNITN
ALVEADYVTLDVHEMLKKLVKNTTPFTSATLRAIKTEKELEYLQKAADIA
ALTCNWIREQDIIGRTELEIATLVSKHMLELGGELNSFDPIIASGPNGGS
PHHHPGNRVIEDGDMVTVDIGCTYKGYCSDITRSFIVGNKANPQMQEIYD
KVLESQTAGINLLSTKVTGQEVDKVCRDIVDNSKFKGYFTHGTGHGVGLQ
VHELPNTNAGNPNKLPLNAVVTVEPGIYIPNVGGVRIEDTIVVKDGQALV
LTRLAYK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGATTTCAAATTACAACAAGTTTTAAAAACAATTAAAGAACATGA
AGCACAAGGCGCTGACGGTATGATTTTATTTTCTAATTATAACCGTTATT
GATTTTTAGAATTTGCTTCAAGTGATGGTTTTGTGTTTATTAATAAAGAT
GGTAAAGCAATTTATCTAGTGGATGCTCGTTATTATACAGCAGCGTCTGA
AACTGTAAAAAACGCAAAGGTAATTTTATTAGCTCGCACACCACAAAAAT
CAACTTTTGATCTACTAAAAGACGCAATGGTTGAATTAAATATTACTAAT
GCATTAGTTGAAGCTGATTATGTAACATTAGATGTTCATGAAATGTTAAA
AAAATTAGTAAAAAATACTACTCCTTTTACATCAGCTACATTACGTGCTA
TTAAAACTGAAAAAGAACTTGAATATTTACAAAAAGCTGCTGATATTGCA
GCTTTAACATGTAATTGAATTCGAGAACAAGATATTATTGGTCGAACAGA
ACTTGAAATTGCAACATTAGTTTCAAAACATATGTTAGAATTAGGTGGAG
AATTAAATTCATTTGATCCAATTATTGCTTCAGGTCCAAATGGCGGATCA
CCACATCATCATCCAGGAAATCGTGTAATTGAAGATGGAGATATGGTAAC
TGTTGACATTGGTTGTACTTATAAAGGTTATTGTTCTGATATTACAAGAT
CTTTTATTGTTGGAAATAAAGCAAATCCACAAATGCAAGAAATTTATGAT
AAAGTTCTTGAATCTCAAACAGCAGGGATTAATCTATTGAGTACAAAAGT
AACAGGTCAAGAAGTTGATAAAGTATGTCGCGACATTGTTGATAATTCTA
AATTTAAGGGCTATTTCACACATGGAACAGGTCATGGTGTAGGTTTACAA
GTACATGAATTACCAAATACTAATGCTGGTAATCCTAATAAATTGCCATT
AAATGCAGTTGTTACTGTTGAACCAGGAATTTATATCCCAAATGTTGGTG
GTGTAAGAATTGAAGATACAATTGTAGTAAAAGACGGACAAGCCCTGGTT
TTAACAAGGTTAGCATATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy