Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Trp-2 IGR443 IGR448 IGR446 IGR449 IGR445 IGR450 IGR447 IGR444 rpL33,rpmG, - UU533 cdd, - UU531 truA,hisT, - UU536 pepP,ampP, - UU532 dcm, - UU528 manB,cpsG, - UU530 thrS,syt, - UU534 UU527 codV, - UU529 UU535 rpL33,rpmG, - UU533 cdd, - UU531 truA,hisT, - UU536 pepP,ampP, - UU532 dcm, - UU528 manB,cpsG, - UU530 thrS,syt, - UU534 UU527 codV, - UU529 UU535 Type: tandem, Name:  - 326 Type: tandem, Name:  - 323 Type: tandem, Name:  - 324 Type: tandem, Name:  - 325 rpL33,rpmG, - UU533 cdd, - UU531 truA,hisT, - UU536 pepP,ampP, - UU532 dcm, - UU528 manB,cpsG, - UU530 thrS,syt, - UU534 UU527 codV, - UU529 UU535
* Calculated from Protein Sequence

Gene ID: UU531

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cdd  

Definition:
cytidine deaminase

Gene Start:
660837

Gene Stop:
660442

Gene Length:
396

Molecular Weight*:
14579

pI*:
5.20

Net Charge*:
-1.16

EC:
3.5.4.5  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; salvage of nucleosides and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Comment:
Cytidine deaminase catalyzes the hydrolysis of cytidine
into uridine and ammonia.

See Prosite PDOC00702.

Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to cytidine deaminases; e.g. residues 1-126 are 44% similar to CDD_MYCPI, residues 1-122 are 38% similar to CDD_BACSU; residues 12-127 are 41% similar to CDD_HUMAN; and residues 12-127 are 41% similar to CDD_MOUSE.
BLAST also reveals similarity to MG052, a cytidine deaminase. No significant similarity to C.trachomatis or T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0295 is ehgp--y-.
Cog name: Cytidine deaminase.
Functional class: F.
BeTs to --g---y-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 17-28, 39-65, 84-96, 116-130, and 9-30 represent blocks PD02269A-D (CYTIDINE DEAMINASE HYDROLASE ZINC AMINOHY.)
Residues 26-45 are in the 99.18th percentile of similarity to block PR00691C (ADHESIN B SIGNATURE)

ProDom Summary:  Protein Domain Search
Residues 1-126 are 44% similar to a defined domain of CDD_MYCPI.

Paralogs:  Local Blast Search
No paralog in U.u.

Pfam Summary:  Pfam Search
Residues 3 to 107 (E-value = 9.6e-10) place UU531 in the dCMP_cyt_deam family which is described as Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383)

PDB Hit:


Gene Protein Sequence:
MKYNDIYMGLLELLKKSYSPYSNYPVAAYVDTDLGFISGVNVENGSFGLT
SCAERNAIFNAIANGAKTFKTVYIITKNNGDIASPCGACRQVIFEFFKKD
AKIVVFNNDGTYKEYNVEQLLPFGWDPNISL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATATAATGATATTTATATGGGATTATTAGAGTTATTAAAAAAAAG
TTATAGTCCTTATTCAAATTATCCAGTTGCTGCTTATGTTGATACTGATT
TAGGATTTATCTCTGGTGTGAATGTTGAAAATGGATCATTTGGATTAACT
TCTTGTGCTGAAAGAAATGCAATCTTTAATGCAATTGCAAATGGTGCAAA
AACATTTAAAACAGTTTATATAATTACAAAAAATAATGGTGATATTGCGA
GTCCTTGTGGTGCATGTCGTCAAGTGATTTTTGAATTTTTTAAAAAGGAT
GCAAAAATCGTCGTTTTTAACAATGATGGTACTTATAAAGAATATAATGT
TGAACAATTATTACCATTTGGATGAGATCCAAATATATCTCTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy