Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Trp-2 IGR443 IGR446 IGR445 IGR447 IGR442 IGR444 cdd, - UU531 pepP,ampP, - UU532 dcm, - UU528 UU526 manB,cpsG, - UU530 UU527 codV, - UU529 cdd, - UU531 pepP,ampP, - UU532 dcm, - UU528 UU526 manB,cpsG, - UU530 UU527 codV, - UU529 Type: tandem, Name:  - 423 Type: tandem, Name:  - 322 Type: tandem, Name:  - 323 Type: tandem, Name:  - 324 cdd, - UU531 pepP,ampP, - UU532 dcm, - UU528 UU526 manB,cpsG, - UU530 UU527 codV, - UU529
* Calculated from Protein Sequence

Gene ID: UU528

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dcm  

Definition:
cytosine-specific methyltransferase

Gene Start:
657652

Gene Stop:
656402

Gene Length:
1251

Molecular Weight*:
48038

pI*:
10.20

Net Charge*:
18.27

EC:
2.1.1.73  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
See Prosite PDOC00089.

High A+T content in middle of cds. Unusual Asn start and puzzling BLAST
results suggest that a reassessment of the start is in order.



Blast Summary:  PSI-Blast Search
Few significant hits and many weak hits to cytosine-specific DNA-methyltransferases; e.g. residues 3-403 are 34% similar to MTSI_SPISQ; residues 7-408 are 28% similar to MTSB_LACLC, and residues 133-403 are 30% similar to MTNX_NEILA.
BLAST reveals no similarity to T.pallidum, M.genitalium, or C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0270 is eh--cM-U.
Cog name: Site-specific DNA methylase.
Functional class: L.
BeTs to e---cm-u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 8-400 span six regions of similarity to blocks BL00094A-F (C-5 cytosine-specific DNA methylases proteins.)

ProDom Summary:  Protein Domain Search
Residues 134-241 are 54% similar, and residues 11-133 are 35% similar to a defined domain of MTSI_SPISQ, a cytosine-specific methyltransferase.
Residues 355-416 are 42% similar to a defined domain of MTBS_BPSPR, a cytosine-specific methyltransferase.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 8 to 412 (E-value = 6.3e-37) place UU528 in the DNA_methylase family which is described as C-5 cytosine-specific DNA methylase (PF00145)

PDB Hit:
gi|443019|pdb|1HMY| Hhai Dna (Cytosine-C5-)-Methyltransferase (E.C.2.1.1.37) Complex With S-Adenosyl-L-Methionine

Gene Protein Sequence:
NIDKTKVLRVFETFSGIGAQHRALEIVKKQFGFDYKIVATSEWDIYANIS
YNTIHYPHKKINLNIDINRIDNYLEKFNHSSNGKDPIRKKISSFSENIKR
ELYDAYLNSNNLGSILSVTGEQLIKSVGNKGIDLLTYSFPCQDLSTAGSF
SKKAFGMKKGSGTRSGLLWEIERILFDLQKLNQLPQFLLLENVNNMLSKQ
HKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLI
DSNGNILDLEAPIFDGKQKQLKDVLKTNYKIEKYYQEAYLAQPNRTFSRI
KYVIPKYDLLNPNCYCTSTITTRQDRFPNGGYINLKNTILGDDYREKDHN
NLPKKANFRLLTNREAYLLMGFNEKDFEAIQAKGISKAKMYQQAGNSIVV
DVMVYLMKLIQERFNK$

Gene Nucleotide Sequence:  Sequence Viewer
AACATAGATAAAACTAAGGTTTTAAGAGTATTTGAAACTTTTTCTGGAAT
TGGAGCACAACATCGTGCTTTAGAAATTGTAAAAAAACAATTTGGCTTTG
ACTACAAAATTGTTGCTACAAGCGAATGAGATATTTATGCAAATATTTCT
TATAACACAATTCATTATCCACATAAAAAAATTAATTTAAATATTGATAT
TAATAGAATTGATAATTATTTAGAAAAATTTAATCACTCATCAAATGGTA
AAGACCCAATTCGTAAAAAAATTAGTTCTTTTAGCGAAAATATTAAACGT
GAATTATATGATGCATATCTTAATTCTAATAATTTAGGAAGTATTTTAAG
TGTGACTGGTGAGCAGTTAATAAAAAGTGTTGGGAACAAAGGGATAGATT
TACTTACTTATTCATTCCCTTGTCAAGACTTATCAACAGCTGGAAGCTTT
AGTAAAAAAGCTTTTGGAATGAAAAAAGGATCCGGTACACGTTCTGGATT
ACTATGAGAAATTGAACGCATTTTATTCGATTTGCAAAAATTAAATCAAT
TACCACAATTTCTTTTATTAGAAAACGTTAATAACATGTTATCTAAACAA
CATAAGCTAGATTATGATATGTGAACCAAATCTTTAAAACAATTAGGTTA
TAGTACATGTACTTTTCAATTAAACGCTCTTGATTATGGGTCAGCACAAC
GTCGTAAACGAGTATATGCAATTTCGATTCTAAACTATGATGGATTAATT
GATAGTAATGGAAATATTTTAGATTTAGAAGCACCTATTTTTGATGGAAA
ACAAAAACAATTAAAGGATGTTTTAAAAACTAATTATAAAATTGAAAAAT
ATTATCAAGAAGCATATTTAGCTCAACCAAATCGCACATTTTCAAGAATA
AAATATGTCATTCCAAAATATGATTTATTAAATCCTAATTGTTATTGTAC
TTCAACAATTACAACACGTCAAGATCGTTTTCCTAATGGTGGTTATATCA
ATTTAAAAAATACGATTTTAGGTGATGATTATCGTGAAAAAGATCACAAT
AATTTACCTAAAAAAGCAAACTTTCGTTTATTAACAAATCGTGAAGCCTA
TCTATTAATGGGCTTTAATGAAAAAGATTTTGAAGCGATTCAAGCTAAGG
GAATATCAAAAGCTAAAATGTATCAACAAGCTGGAAATTCAATTGTTGTT
GATGTAATGGTTTATTTAATGAAATTAATTCAAGAAAGATTTAATAAATA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy