Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR439 IGR440 IGR436 IGR433 IGR435 IGR437 IGR434 IGR438 rpsL,rpS12, - UU525 rpsG,rpS7, - UU524 tufA,eftU, - UU522 UU519 pepF, - UU521 UU520 fusA,efG, - UU523 UU518 rpsL,rpS12, - UU525 rpsG,rpS7, - UU524 tufA,eftU, - UU522 UU519 pepF, - UU521 UU520 fusA,efG, - UU523 UU518 Type: tandem, Name:  - 318 Type: tandem, Name:  - 319 Type: tandem, Name:  - 320 rpsG,rpS7, - UU524 tufA,eftU, - UU522 UU519 pepF, - UU521 UU520 fusA,efG, - UU523 rpsL,rpS12, - UU525 UU518
* Calculated from Protein Sequence

Gene ID: UU521

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pepF  

Definition:
oligoendopeptidase F

Gene Start:
647146

Gene Stop:
645311

Gene Length:
1836

Molecular Weight*:
72465

pI*:
6.90

Net Charge*:
-0.96

EC:
3.4.24.-  

Functional Class:
translation; degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:
See UU065, a predicted pepF sequence; UU507, a predicted pepA sequence; and UU532, a predicted pepP sequence.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to oligoendopeptidase F sequences and homologs; e.g. residues 6-595 are 35% similar to PEPF_MYCPN; residues 2-597 are 28% similar to the pepF gene (AE001135) of B.burgdorferi; and residues 7-597 are 25% similar to PEPF_LACLA.
BLAST reveals similarity to MG183 and CT112, both of which are predicted oligoendopeptidases. No significant similarity to T.pallidum.


COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 384-394 are in the 99.33th percentile of similarity to block BL00142 (Neutral zinc metallopeptidases, zinc-binding region proteins.)

ProDom Summary:  Protein Domain Search
Residues 99-586 are 38% similar to a defined domain of PEPF_MYCPN, an oligoendopeptidase F protein.


Paralogs:  Local Blast Search
Residues 4-610 are 43 % similar to UU065, an oligoendopeptidase F.


Pfam Summary:  Pfam Search
Residues 196 to 590 (E-value = 1e-60) place UU521 in the Peptidase_M3 family which is described as Peptidase family M3 (PF01432)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
85
non-globular  
544  
611

PDB Hit:


Gene Protein Sequence:
MNDINDKKYDWDIDSLLKGKKLDILFNEFVESNNELIKAFEKWINSLNDF
INFHEVSEKNLLISNRINNYVSNKLQTNLIDNEMLAWSQKIEHEQHRVAK
IFINFENLAIKNKDLINSYLKNSSLIKYQLEYEELWRYEKHILNEQQQKV
VTAISRFSSSFGDIFDVLLDSDMQYQDGINYKKQKVCFKNQTDLYVASKS
NDRALRKSAYESHFKAIYDLRNTFSKLLYYEYVKQNELAKLHNFKDYISA
DAFSDKVDKNFINHIYTQTKKFAKGINRYTKYRTLFLKQQYQLTKVEPWD
KNLDIIDKKNMFSIESAKNLTLEALALLGSEYINVVQRAFNEQWISWMPN
NNKISGAYSISNTKGLDKIFILMNYDETYNSILTLVHELGHSVHTYFANQ
SQEVYNEYETFYAEIASITNEILMNYHLLKKYENDDLMRLYILDEMISGF
IATTTRQAIFSNFEWVANEWINQGEEFSWNKIVLAYLEINHDYTGYKYNK
NKISKYDEANALILINIPHFYTGNFYVYKYVIGQICGLINAIRIFNNKAN
AKEKYFCFFKSGGSLSPLETINILDIKINENDVWEEVNIIFNSWIDDYIK
IIKKFLINKKI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGATATTAATGATAAAAAATATGATTGAGATATAGATTCATTATT
AAAAGGCAAGAAACTAGATATTTTGTTCAATGAATTTGTTGAATCAAATA
ATGAATTAATAAAAGCTTTTGAAAAGTGGATTAATAGTTTAAATGATTTT
ATTAATTTTCACGAAGTTTCAGAAAAAAATTTATTAATTAGTAATCGAAT
TAACAATTATGTTTCAAATAAATTGCAAACAAATTTAATCGATAATGAAA
TGCTTGCTTGGTCTCAAAAAATTGAACATGAACAACATCGTGTAGCTAAA
ATTTTTATTAATTTTGAAAATTTAGCAATAAAAAATAAAGATTTAATTAA
TTCATATTTAAAAAATTCTTCATTAATTAAATACCAATTAGAATATGAAG
AATTATGACGTTACGAAAAACATATTTTAAATGAACAACAACAAAAAGTT
GTTACAGCTATTAGCCGTTTTAGTTCAAGTTTTGGTGATATTTTTGATGT
TTTATTAGATTCAGATATGCAGTATCAGGATGGTATAAACTATAAAAAAC
AAAAAGTTTGTTTTAAAAATCAAACTGATCTTTATGTTGCATCTAAATCA
AATGATCGTGCTTTACGAAAATCAGCTTATGAATCTCATTTTAAAGCGAT
ATATGATTTACGTAATACTTTTAGTAAATTATTATATTATGAATATGTTA
AACAAAACGAGTTAGCAAAATTACATAATTTTAAGGATTATATTTCTGCG
GATGCTTTTAGTGATAAGGTTGATAAAAATTTTATAAATCATATTTATAC
ACAAACAAAAAAATTTGCTAAAGGAATTAATAGATATACAAAATATCGAA
CATTATTTCTAAAACAACAATATCAATTAACTAAAGTTGAACCATGAGAT
AAAAATTTAGATATAATTGATAAAAAAAACATGTTTAGTATTGAATCTGC
TAAAAACTTAACTTTAGAAGCTTTGGCATTATTAGGTAGTGAATATATAA
ATGTTGTACAAAGAGCGTTCAATGAGCAATGAATATCATGAATGCCAAAT
AATAATAAAATTTCTGGAGCATATTCTATAAGTAACACTAAAGGCTTAGA
TAAAATTTTTATTTTAATGAATTATGATGAAACTTATAATTCTATTTTAA
CATTAGTTCATGAATTAGGGCATTCTGTACACACTTATTTTGCTAATCAA
TCACAAGAAGTATATAATGAATATGAAACCTTTTATGCAGAAATTGCTTC
CATTACTAATGAGATCTTAATGAATTACCATTTATTAAAGAAATACGAAA
ATGATGATTTAATGCGTCTTTATATTTTAGATGAAATGATTAGTGGTTTT
ATTGCTACAACTACACGCCAAGCGATTTTTTCAAATTTTGAGTGAGTTGC
CAATGAATGAATTAATCAAGGTGAAGAATTTAGCTGAAATAAAATAGTTT
TAGCTTATCTAGAAATAAATCATGATTATACAGGATATAAATATAATAAA
AACAAAATCAGTAAATATGATGAAGCAAACGCTTTAATTTTAATTAACAT
TCCACATTTTTATACTGGTAATTTTTATGTATATAAATATGTTATTGGAC
AAATTTGTGGATTAATTAATGCGATAAGAATTTTCAATAATAAAGCAAAC
GCTAAAGAAAAATATTTCTGTTTTTTTAAATCTGGAGGGAGTTTGTCTCC
TCTTGAAACAATTAATATTTTAGATATAAAAATTAATGAGAACGATGTTT
GAGAAGAAGTTAATATAATTTTTAATAGTTGAATCGATGATTATATAAAA
ATAATTAAAAAATTTTTAATAAATAAAAAAATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy