Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-1 tRNA-Val-1 tRNA-Thr-1 tRNA-Lys-2 tRNA-Glu-1 tRNA-Leu-3 IGR431 IGR427 IGR428 IGR432 IGR429 IGR426 IGR430 rrf, - UU512 pyrH, - UU513 tsf,eftS, - UU514 cdsA, - UU511 UU509 fatC, - UU516 UU515 UU517 cbiO,msbA,ABC, - UU510 rrf, - UU512 pyrH, - UU513 tsf,eftS, - UU514 cdsA, - UU511 UU509 fatC, - UU516 UU515 UU517 cbiO,msbA,ABC, - UU510 Type: tandem, Name:  - 315 Type: tandem, Name:  - 434 Type: tandem, Name:  - 314 Type: tandem, Name:  - 387 Type: tandem, Name:  - 312 Type: tandem, Name:  - 422 Type: tandem, Name:  - 317 Type: tandem, Name:  - 313 Type: tandem, Name:  - 316 rrf, - UU512 pyrH, - UU513 tsf,eftS, - UU514 cdsA, - UU511 UU509 fatC, - UU516 UU515 UU517 cbiO,msbA,ABC, - UU510 UU510.1 UU510.1
* Calculated from Protein Sequence

Gene ID: UU513

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrH  

Definition:
uridylate kinase

Gene Start:
635541

Gene Stop:
634834

Gene Length:
708

Molecular Weight*:
25910

pI*:
7.30

Net Charge*:
0.53

EC:
2.7.4.-  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; pyrimidines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to uridylate kinase sequences; e.g. residues 3-233 are 41% similar to 3845027 (U39725), a uridylate kinase of M.genitalium; residues 5-235 are 37% similar to PYRH_MYCPN; residues 1-235 are 38% similar to (AJ235270) a uridylate kinase of Rickettsia prowazekii). Also significant similarities to: PYRH_SYNY3, PYRH_HAEIN, PYRH_ECOLI, PYRH_HELPY, PYRH_MYCTU, PYRH_CHLTR, and PYRH_METJA.
BLAST reveals significant similarity to CT678 and MG434, both uridylate kinases.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0528 is ehgpcm-u.
Cog name: Uridylate kinase.
Functional class: F.
BeTs to -h-pcm-u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 115-233 are 47% similar to a defined domain of PYRH_MYCGE.
Rsidues 4-78 are 38% similar to a defined domain of PYRH_HAEIN.
Residues 5-88 are 32% similar to defined domain of O28237_ARCFU, a uridylate kinase.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 4 to 213 (E-value = 2.1e-41) place UU513 in the AA_kinase family which is described as Amino acid kinase family (PF00696)

PDB Hit:


Gene Protein Sequence:
MRKQRIVIKISGACLKQNDSSIIDFIKINDLAEQIEKISKKYIVSIVLGG
GNIWRGSIAKELDMDRNLADNMGMMATIINGLALENALNHLNVNTIVLSA
IKCDKLVHESSANNIKKAIEKEQVMIFVAGTGFPYFTTDSCAAIRAAETE
SSIILMGKNGVDGVYDSDPKINPNAQFYEHITFNMALTQNLKVMDATALA
LCQENNINLLVFNIDKPNAIVDVLEKKNKYTIVSK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGAAAACAACGAATTGTAATTAAAATTTCTGGAGCTTGCTTAAAACA
AAATGATAGTTCAATAATTGATTTTATAAAGATTAATGATTTAGCAGAAC
AAATTGAAAAAATTTCTAAGAAATATATTGTATCAATTGTTTTAGGTGGT
GGCAATATTTGACGAGGTAGCATTGCCAAAGAGCTAGATATGGATCGTAA
TTTAGCTGATAATATGGGTATGATGGCAACTATTATAAATGGGTTAGCTT
TAGAAAATGCTTTAAATCATTTGAATGTTAACACTATTGTTTTATCTGCA
ATTAAATGTGATAAATTAGTTCATGAATCATCTGCTAATAATATAAAAAA
AGCTATTGAAAAAGAACAAGTAATGATTTTTGTGGCTGGAACAGGATTTC
CATATTTTACAACTGATTCGTGTGCAGCAATTAGAGCTGCTGAAACAGAA
TCTAGTATAATTTTAATGGGCAAAAATGGTGTTGATGGTGTCTATGATAG
TGATCCAAAAATTAATCCTAATGCACAATTTTATGAACATATTACATTTA
ATATGGCCCTTACTCAAAATTTAAAAGTTATGGATGCAACAGCTTTAGCT
TTGTGTCAAGAAAATAATATAAATTTATTAGTTTTTAATATTGATAAACC
AAATGCAATTGTTGATGTTTTAGAGAAAAAAAATAAATACACAATTGTTT
CAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy