Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-1 tRNA-Val-1 tRNA-Thr-1 tRNA-Lys-2 tRNA-Glu-1 tRNA-Leu-3 IGR431 IGR427 IGR425 IGR428 IGR429 IGR426 IGR430 rrf, - UU512 pyrH, - UU513 tsf,eftS, - UU514 cdsA, - UU511 UU509 ftsK, - UU508 fatC, - UU516 UU515 cbiO,msbA,ABC, - UU510 rrf, - UU512 pyrH, - UU513 tsf,eftS, - UU514 cdsA, - UU511 UU509 ftsK, - UU508 fatC, - UU516 UU515 cbiO,msbA,ABC, - UU510 Type: tandem, Name:  - 313 Type: tandem, Name:  - 422 Type: tandem, Name:  - 312 Type: tandem, Name:  - 316 Type: tandem, Name:  - 310 Type: tandem, Name:  - 387 Type: tandem, Name:  - 315 Type: tandem, Name:  - 311 Type: tandem, Name:  - 434 Type: tandem, Name:  - 314 rrf, - UU512 pyrH, - UU513 tsf,eftS, - UU514 cdsA, - UU511 UU509 ftsK, - UU508 fatC, - UU516 UU515 cbiO,msbA,ABC, - UU510 UU510.1 UU510.1
* Calculated from Protein Sequence

Gene ID: UU511

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cdsA  

Definition:
phosphatidate cytidylytransferase (CDP diglyceride synthetase)

Gene Start:
634254

Gene Stop:
633118

Gene Length:
1137

Molecular Weight*:
43600

pI*:
10.10

Net Charge*:
13.90

EC:
2.7.7.41  

Functional Class:
fatty acid and phospholipid metabolism; biosynthesis  

Pathway: pathway table
Glycerolipid metabolism

Comment:
This enzyme, an integral membrane protein, catalyzes the conversion of phosphatidate to
CDP-diacylglycerol.

See Prosite PDOC01019.

Somehwat high A+T content at 5' end and displacement in alignmnet with MG437. Has
correct start been located?

Blast Summary:  PSI-Blast Search
BLAST reveals similarity to MG437, a probable CDP-diglyceride synthetase;
CT451, a predicted phosphatidate cytidylytransferase; and TP0602, a predicted CDP-diacylglycerol synthase.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0575 is Ehgpc-yu.
Cog name: CDP-diglyceride synthetase.
Functional class: I.
BeTs to e-g-c-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Hits in gapped BLAST generally exclude first 175 residues. Second half of sequence shows numerous hits to phosphatidate cytidylytransferases; e.g. residues 181-373 are 36% similar to CDSA_MYCGE; residues 192-360 are 34% similar to CDSA_ECOLI; residues 192-356 are 33% similar to CDSA_HAEIN, and residues 198-378 are 29% similar to CDS1_RAT.
Residues 187-218, 220-233, and 298-341 represent a significant (100%) hit to blocks BL01315A-C (Phosphatidate cytidylyltransferase proteins.)
Residues 220-235 are in the 00.09th percentile of similarity to block PR01027 (OMS28 PORIN SIGNATURE)

ProDom Summary:  Protein Domain Search
Residues 139-244 are 38% similar, and 291-355 are 44% similar to a defined domain of CDSA_MYCGE, a CDP-diglyceride synthase.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 53 to 356 (E-value = 1.8e-22) place UU511 in the CTP_transf_1 family which is described as Cytidylyltransferase family (PF01148)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
20  
40
transmembrane  
50  
76
transmembrane  
87  
114
transmembrane  
120  
147
transmembrane  
151  
178
transmembrane  
182  
210
transmembrane  
228  
254
transmembrane  
290  
312
transmembrane  
342  
358

PDB Hit:


Gene Protein Sequence:
MISVNKINEKTKNTFFKRFYSSIFIFLYLLIYFVLALLADRNYNWTPLIN
NLYIQQGIAIVLLIWLLPLICIGSYEMNKVIFDNNKITLIILTIVFNICI
YTTTISYFIYQYEFLNIKYLLTINYHYVIKLFGACLGCSYFVTLVILFFF
LAFLKKINFKNCLYTILIFSFLSGFFIGLLYFTFIRSWITSLLLMMIVFL
SDTFAYVGGVLFGKTKLAPKISPNKTVEGLIFGLVIATIVIMLIIFGLSY
VPIKPKNGIVLKSQNVLYNIFGLDFSSSNEKNLTLHKQALWWICTIVAFL
FLSLISTSGDLVFSAIKRNYHTKDYSNLIPGHGGLLDRIDSHSFVISIMF
IFTLLITGSLQDENLFPNIQKFFIQLIV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAGTGTCAATAAAATCAATGAAAAAACAAAAAACACTTTTTTTAA
ACGGTTTTATTCATCGATTTTTATTTTTTTATACTTATTAATTTATTTTG
TTTTAGCATTATTAGCAGATCGTAATTATAATTGAACACCTTTAATTAAT
AATTTATATATTCAACAAGGGATTGCAATTGTTTTATTAATATGATTATT
ACCATTAATATGTATTGGTTCGTATGAAATGAATAAAGTCATTTTTGATA
ATAATAAGATAACATTAATCATCTTAACAATTGTTTTTAATATTTGCATT
TATACTACAACGATTTCTTATTTTATATATCAATATGAGTTTTTAAATAT
TAAATACCTTTTAACTATAAATTACCATTACGTCATCAAACTATTTGGCG
CATGTTTAGGATGCTCGTATTTTGTTACATTAGTTATTTTATTTTTCTTT
TTAGCATTTCTAAAAAAAATTAATTTCAAAAATTGTTTATACACAATTTT
AATTTTTAGTTTTTTAAGTGGTTTTTTTATAGGATTACTTTATTTTACTT
TTATTAGAAGTTGAATTACTTCATTATTGCTAATGATGATTGTTTTTTTA
AGTGATACATTTGCATATGTTGGTGGTGTTTTATTTGGTAAAACAAAATT
AGCACCAAAAATAAGTCCTAACAAAACAGTTGAAGGATTAATTTTTGGTT
TAGTAATTGCAACAATTGTTATTATGTTAATAATTTTTGGTTTGTCATAT
GTGCCAATTAAACCTAAAAACGGCATAGTGTTAAAATCACAAAATGTTTT
ATATAATATTTTTGGTTTAGATTTTTCTAGTTCAAATGAAAAAAATCTTA
CATTGCATAAACAAGCATTATGATGAATTTGCACAATAGTTGCTTTTTTG
TTTTTGAGTTTAATAAGCACTAGTGGGGACTTAGTATTTAGTGCGATTAA
ACGTAATTATCATACCAAAGATTATAGTAATTTAATTCCTGGCCATGGTG
GATTATTAGATCGTATAGATTCACATTCATTTGTAATATCAATCATGTTC
ATTTTTACACTTCTTATTACAGGCAGTTTACAAGATGAAAATTTATTTCC
TAACATTCAAAAATTTTTTATTCAATTAATTGTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy