Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR412 IGR413 IGR411 UU489 UU495 UU492 era, - UU491 priM,dnaG, - UU494 UU489 UU495 UU492 era, - UU491 priM,dnaG, - UU494 Type: tandem, Name:  - 419 Type: tandem, Name:  - 293 Type: tandem, Name:  - 294 Type: tandem, Name:  - 295 UU489 UU495 UU492 era, - UU491 priM,dnaG, - UU494 UU490 syg,glyS, - UU493 UU490 syg,glyS, - UU493
* Calculated from Protein Sequence

Gene ID: UU494

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
priM  dnaG  

Definition:
DNA primase

Gene Start:
591955

Gene Stop:
593880

Gene Length:
1926

Molecular Weight*:
75383

pI*:
9.80

Net Charge*:
20.03

EC:
2.7.7.-  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Ubiquinone biosynthesis

Comment:
DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments on both template strands at replication forks during chromosomal DNA synthesis.

The complete list of dna() genes in U.u. are: UU001, a predicted dnaA sequence; UU019, a predicted dnaH sequence; UU079, a predicted dnaN sequence; UU087, a predicted dnaX sequence; UU339, a predicted dnaK sequence; UU407, a predicted dnaJ sequence; UU415, a predicted dnaE sequence; UU494, a predicted dnaG sequence; and UU550, a predicted dnaB sequence.

Blast Summary:  PSI-Blast Search
Numerous significant hits over first 450 residues in gapped BLAST to DNA primases; e.g. residues 3-448 are 29% similar to (AJ235273) DNA PRIMASE (dnaG) of Rickettsia prowazekii; residues 3-448 are 29% similar to PRIM_RICPR; residues 4-457 are 29% similar to PRIM_CLOAB; and residues 1-418 are 28% similar to PRIM_LACLA.
BLAST also reveals significant similarity to MG250, TP0492, and CT794, all of which are DNA primases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0358 is ehGPcm-u.
Cog name: DNA primase (bacterial type) and small primase-like proteins.
Functional class: L.
BeTs to -hg-c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 28-361 span six regions of similarity to blocks DM01482A-F (kw PRIMASE DNA.)

ProDom Summary:  Protein Domain Search
Residues 220-369 are 37% similar to a defined domain of PRIM_RICPR, a DNA primase.
Residues 16-90 are 49% similar to a defined domain of O67465_AQUAE, a DNA primase.

Paralogs:  Local Blast Search
Possible paralogs are UU443, UU527, UU293, and UU292, all hypotheticals.

Pfam Summary:  Pfam Search
Residues 4 to 101 (E-value = 1.7e-29) place UU494 in the zf-CHC2 family which is described as CHC2 zinc finger (PF01807)
Residues 266 to 346 (E-value = 3.4e-12) place UU494 in the Toprim family which is described as Toprim domain (PF01751)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
68  
242
non-globular  
393  
590
coil-coil  
592  
641

PDB Hit:


Gene Protein Sequence:
MSKITNNVFLTIRNAINISDVIQNYIKVIKKGNNYWAICPFHNDTNESLS
INDKKQIFKCFACNHAGDVIKFVAEYKKISYALAAQEIVQLMNLDLNLLN
HLQKISPQEIKKNKVFDLNKQIQKWFINFLNNKNNIHVIDYLTKRNLNKN
DLAYFKIGYAPNNDELLNLIKSNYNNLIQENDEFELNKLIENSFLVIDKN
GNYHDFFNDRIIFSIYDHLNNVVGFSGRIITNEKTPKYLNTKTTAVFKKD
EVLYNFHNVITIENNHQLFIVEGFMDVITIHKSNKPNVVATMGVELTNKH
LELIKSYGIKDLILCFDNDQAGFLATKKQIMKLINSPFNIFIVNHKDNDC
KDMDEYANKHGYSATSKLLDQQLHISEFLLLEISNTNKSTPSLKHSYKQE
CFTIIKKYGDIFYVDKYVDFMKQTFSIEENLLKKVIEELLINKQCNSIQN
KKNIQSYQKQTQLTNKLTTSNPKVILTKIDKHFNHLVVIILMNRVFLNRL
DTQVRNRLTKEQSLVINIIEDFYLYHFKINNILKNTDSFIEFINKNYSKY
TNVINQLTKMVQIIKYNPKFDNIVAFELAKNNFIYEWLNNQIKRLKLINL
NLNMNNNQEQIINNEKLIKQYNDEKILLDNLINASLFHKNQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAAAATAACTAACAATGTTTTTTTAACAATTCGTAATGCTATAAA
TATTTCCGATGTTATTCAAAATTACATTAAAGTAATTAAAAAGGGTAATA
ATTATTGAGCTATTTGTCCATTTCACAATGATACAAATGAATCATTGTCA
ATCAATGATAAAAAACAAATCTTTAAATGTTTTGCTTGTAATCATGCTGG
TGATGTGATTAAATTTGTTGCTGAATATAAAAAGATCTCCTATGCTTTAG
CAGCACAAGAGATTGTTCAATTAATGAATTTAGATTTAAACTTATTGAAT
CATTTACAAAAAATTTCTCCACAAGAAATTAAAAAAAATAAGGTTTTTGA
TTTAAACAAACAAATTCAAAAATGATTTATTAATTTTTTAAATAATAAAA
ATAACATTCATGTTATTGATTATTTAACTAAACGAAATTTAAATAAAAAT
GATTTAGCATATTTTAAAATCGGTTATGCTCCAAATAATGATGAATTATT
AAATTTAATAAAATCTAATTATAATAATCTGATACAAGAAAATGACGAGT
TTGAATTAAATAAATTAATAGAAAATTCCTTTTTAGTAATTGATAAGAAT
GGTAATTACCATGATTTTTTTAATGATCGTATTATTTTTAGTATTTATGA
TCATCTCAATAACGTTGTTGGTTTTAGCGGACGTATAATTACAAATGAGA
AAACACCAAAATATTTAAATACTAAAACCACTGCTGTATTTAAAAAAGAT
GAAGTTCTTTATAATTTTCATAATGTTATCACCATTGAAAATAATCATCA
ATTATTTATAGTTGAAGGTTTTATGGATGTTATTACAATTCATAAATCTA
ACAAACCAAACGTTGTAGCAACAATGGGTGTTGAATTAACTAATAAACAT
TTAGAATTAATTAAAAGCTATGGAATTAAAGATTTAATTTTATGTTTTGA
TAACGATCAAGCAGGTTTTTTAGCTACTAAAAAACAAATTATGAAATTAA
TTAATTCCCCATTCAACATTTTTATTGTTAATCATAAAGATAATGATTGC
AAAGACATGGATGAATATGCAAATAAGCACGGTTATAGTGCAACAAGTAA
GCTATTAGACCAACAACTTCATATTAGTGAATTTTTATTATTAGAAATTA
GTAATACAAACAAATCTACCCCCTCACTAAAACACAGTTATAAACAAGAG
TGTTTTACAATCATTAAAAAATATGGTGATATTTTTTATGTAGATAAATA
TGTTGATTTCATGAAACAAACATTTTCAATTGAAGAAAATTTATTAAAAA
AAGTTATTGAAGAATTATTAATTAACAAACAATGTAATTCTATTCAAAAC
AAAAAGAACATTCAATCATATCAAAAACAAACACAACTAACTAATAAACT
TACTACTTCAAACCCAAAAGTTATCCTAACAAAAATTGATAAACATTTTA
ACCACTTAGTAGTAATTATATTAATGAATCGGGTTTTCTTAAACCGTCTT
GATACGCAAGTTCGTAACCGGTTAACTAAAGAGCAAAGTTTAGTGATTAA
TATTATAGAAGACTTTTATTTGTACCATTTTAAGATTAATAATATTTTAA
AAAACACTGATTCTTTTATTGAATTTATTAATAAAAACTACAGTAAATAT
ACTAATGTTATTAACCAACTTACAAAAATGGTGCAGATTATTAAATATAA
CCCTAAGTTTGATAATATAGTGGCATTTGAACTAGCTAAAAATAATTTTA
TATATGAATGATTAAACAACCAAATTAAACGTTTAAAACTCATCAATCTA
AATTTAAATATGAATAATAACCAAGAACAAATCATAAATAATGAAAAATT
AATAAAGCAATATAATGATGAAAAAATTTTATTAGACAATTTAATCAATG
CTTCTTTATTTCATAAAAATCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy