Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR412 IGR413 IGR411 UU489 UU495 UU492 era, - UU491 priM,dnaG, - UU494 UU489 UU495 UU492 era, - UU491 priM,dnaG, - UU494 Type: tandem, Name:  - 419 Type: tandem, Name:  - 293 Type: tandem, Name:  - 294 Type: tandem, Name:  - 295 UU489 UU495 UU492 era, - UU491 priM,dnaG, - UU494 UU490 syg,glyS, - UU493 UU490 syg,glyS, - UU493
* Calculated from Protein Sequence

Gene ID: UU493

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
syg  glyS  

Definition:
glycyl-tRNA synthetase

Gene Start:
590546

Gene Stop:
591967

Gene Length:
1422

Molecular Weight*:
55565

pI*:
7.50

Net Charge*:
3.27

EC:
6.1.1.14  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glycine, serine and threonine metabolism

Comment:
See Prosite PDOC00363.

The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glycyl-tRNA synthetases; e.g. residues 4-455 are 46% similar to SYG_MYCGE; residues 9-469 are 46% similar to (AE001142) glyS gene of Borrelia burgdorferi; and residues 9-462 are 38% similar to SYG_THETH. Also similar to: SYG_METTH, SYG_METJA, SYG_ARCFU, SYG_HUMAN, and SYG_YEAST.
BLAST also reveals significant similarity to MG251 and TP0672, both of which are glycyl-tRNA synthetases. No significant similarity to C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0423 is --gp-mY-.
Cog name: Glycyl-tRNA synthetase.
Functional class: J.
BeTs to --g--my-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 189-221 are in the 99.71th percentile of similarity to block PD02958C (SYNTHETASE LIGASE PROLYL-TRNA PRORS AMINOA.)
Residues 363-385, 178-197, and 225-246 are in the 97.44th percentile of similarity to blocks PR00828B,G,H (FORMIN SIGNATURE)

ProDom Summary:  Protein Domain Search
Residues 9-151 are 45% similar to a defined domain of SYG_MYCPN.
Residues 152-228 are 72% similar to a defined domain of O51344_BORBU, a tRNA synthetase.
Residues 26-90 are 44% similar to a defined domain of SYG_METHTH.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 33 to 255 (E-value = 3.2e-57) place UU493 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 370 to 462 (E-value = 5.3e-19) place UU493 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
334  
396

PDB Hit:
gi|2392169|pdb|1ATI|A Chain A, Crystal Structure Of Glycyl-Trna Synthetase From Thermus Thermophilus

Gene Protein Sequence:
MRYKFKTQEDLVNHLKSVGFVFANSEIYNGLANAWDYGPLGVLLKNNLKN
LWWKEFVTKQKNIVGLDSAIILNPLVWKASGHLDNFSDPLIDCKSCKTRY
RADKLIESFNKDIHIAENSTNEEFMKVLNDHKIFCPTCKQFNWTDIRHFN
LMFKTHQGVIEDPKNIVYLRPETAQGIFVNFKNVQRSMRLHLPFGIAQIG
KSFRNEITPGNFIFRTREFEQMEIEFFLKEEIAYDVFDKYLNQIQNWLVT
CCGLDLNNLRKHEHPKEELSHYSKKTIDFEYNFLHGFSELYGIAYRTNYD
LSVHMNLSKKDLTYFDEETKQKYIPHVIEPSVGVERLLYAILTEATFIEK
LANDEDRILMNLKYDLAPYKIAVMPLVNKLKEKAEAVYNKILDLNISVTF
DNSGSIGKRYRRQDAIGTIYCITIDYDSFGDEHDPTFTIRERNTMAQKRI
KLSELSLYLSQKAHEDFQKQCQK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGATATAAATTTAAAACACAAGAAGACTTAGTAAATCATTTAAAATC
TGTTGGTTTTGTTTTTGCAAATTCAGAAATATATAATGGATTAGCTAACG
CATGAGATTATGGACCATTAGGTGTATTATTAAAAAATAATTTAAAAAAT
TTGTGGTGGAAGGAATTTGTTACTAAACAAAAAAACATTGTAGGTTTAGA
TAGTGCCATCATTTTAAACCCCTTAGTATGAAAAGCAAGTGGACATTTAG
ATAATTTTTCAGACCCATTAATTGATTGTAAAAGTTGTAAAACAAGATAT
CGTGCTGACAAATTGATTGAATCTTTTAATAAAGATATTCATATTGCTGA
AAATTCTACTAATGAAGAATTTATGAAAGTTTTAAATGATCATAAGATCT
TCTGTCCTACATGCAAACAATTTAATTGAACTGATATTCGTCATTTTAAC
CTTATGTTTAAAACACACCAAGGAGTAATTGAAGATCCTAAAAACATCGT
TTATTTAAGACCAGAAACCGCTCAAGGTATTTTTGTTAACTTTAAAAATG
TTCAGCGATCAATGCGTTTACACTTACCATTTGGGATTGCACAAATAGGT
AAATCATTTAGAAATGAAATAACTCCTGGTAATTTTATTTTTAGAACTCG
TGAATTTGAACAAATGGAAATTGAATTTTTCTTAAAAGAAGAAATTGCAT
ATGATGTTTTTGATAAATATTTAAACCAAATTCAAAATTGATTAGTTACT
TGTTGCGGATTAGATTTGAATAATTTAAGAAAACATGAACATCCCAAAGA
AGAATTATCACACTATTCAAAAAAAACAATTGATTTTGAATATAATTTCT
TACATGGTTTTTCTGAATTATATGGAATTGCATACCGAACTAATTATGAT
TTATCTGTGCATATGAATTTATCAAAAAAAGATTTAACATATTTTGATGA
AGAAACTAAGCAAAAATATATTCCTCATGTTATTGAACCATCAGTTGGTG
TAGAAAGATTATTGTATGCTATTTTAACTGAGGCTACATTTATTGAAAAA
CTAGCAAATGATGAAGACCGAATTTTAATGAATTTAAAATATGATCTAGC
CCCTTATAAAATTGCTGTAATGCCATTAGTTAATAAATTAAAAGAAAAAG
CAGAAGCAGTTTATAATAAAATTTTGGATTTAAATATTTCAGTAACTTTT
GATAATAGCGGAAGTATAGGCAAACGCTATCGCCGTCAAGATGCTATAGG
AACAATTTATTGTATAACAATTGATTATGATTCATTTGGTGATGAACACG
ATCCTACTTTTACTATTCGTGAACGAAACACAATGGCTCAAAAAAGAATT
AAATTATCAGAGTTATCTTTATATTTAAGCCAAAAAGCTCATGAAGATTT
TCAAAAGCAATGTCAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy