Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR410 IGR412 IGR409 IGR411 apt, - UU488 UU487 UU489 UU492 era, - UU491 priM,dnaG, - UU494 apt, - UU488 UU487 UU489 UU492 era, - UU491 priM,dnaG, - UU494 Type: tandem, Name:  - 419 Type: tandem, Name:  - 293 Type: tandem, Name:  - 294 Type: tandem, Name:  - 295 apt, - UU488 UU487 UU489 UU492 era, - UU491 priM,dnaG, - UU494 UU490 syg,glyS, - UU493 UU490 syg,glyS, - UU493
* Calculated from Protein Sequence

Gene ID: UU490

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
588434

Gene Stop:
588901

Gene Length:
468

Molecular Weight*:
18433

pI*:
6.00

Net Charge*:
-3.70

EC:
 

Functional Class:
unknown; conserved hypothetical protein  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Several weak hits in gapped BLAST to hypothetical protein sequences; e.g. residues 46-148 are 36% similar to YQFG_BACSU (sp|P46347); residues 11-143 are 27% similar to YD54_AQUAE (sp|O67367); residues 46-143 are 33% similar to YBEY_HAEIN (sp|P71335).

UU490 is weakly similar to MP0273, a hypothetical protein from M. pneumoniae (score of 56 and an E value of 2e-09 while UU490 has a score of 320 and an E value of 6e-89). No significant similarity to C. trachomatis, C. pneumoniae, M. genitalium, or T. pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0319 is ehgpc--u.
Cog name: Uncharacterized BCR (putative metal-binding protein).
Functional class: R.
BeTs to -h-pc--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 54-71 and 110-140 are in the 100th percentile of similarity to blocks BL0130A,B (Uncharacterized protein family UPF0054 proteins.)

ProDom Summary:  Protein Domain Search
Residues 46-148 are 45% similar to a defined domain of YQFG_BACSU.
Residues 51-139 are 32% similar to a defined domain of Y388_MYCPN.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 46 to 141 (E-value = 1.4e-36) place UU490 in the UPF0054 family which is described as Uncharacterized protein family UPF0054 (PF02130)

PDB Hit:


Gene Protein Sequence:
MHFLITNEVKKIFNDKLYSQRFKQITDLVSTKLNIDKKRFFECHFVDEKT
IQEINKNYRNKDYITDVISFAFDDGEIITPLLGEMYICYQKVVDQASQFA
HSFERELCFLFTHGLLHLLGYDHIKIEDEKIMFALQDEILNELKITRNIN
GARND$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATTTTTTAATAACGAATGAAGTTAAAAAAATCTTTAATGATAAATT
ATATTCACAGCGTTTTAAACAAATAACCGATTTGGTCTCCACAAAATTAA
ATATTGATAAAAAGCGATTTTTTGAATGTCATTTTGTTGATGAAAAAACG
ATACAAGAAATTAATAAAAACTATCGTAATAAAGACTATATTACAGATGT
TATTAGTTTTGCATTTGATGATGGCGAAATTATTACTCCTTTATTGGGAG
AAATGTACATTTGCTATCAAAAGGTTGTTGATCAAGCAAGTCAATTTGCT
CATTCATTCGAACGTGAACTATGCTTTTTATTTACACATGGTTTACTTCA
TTTATTAGGTTATGATCATATAAAAATTGAAGATGAAAAAATTATGTTTG
CTTTACAAGATGAAATTTTAAATGAATTAAAAATTACAAGAAATATAAAT
GGTGCTAGAAATGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy