Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR410 IGR408 IGR407 IGR409 IGR411 apt, - UU488 mnu,nucA, - UU486 UU485 UU487 UU489 UU492 era, - UU491 apt, - UU488 mnu,nucA, - UU486 UU485 UU487 UU489 UU492 era, - UU491 Type: tandem, Name:  - 418 Type: tandem, Name:  - 291 Type: tandem, Name:  - 292 Type: tandem, Name:  - 293 apt, - UU488 mnu,nucA, - UU486 UU485 UU487 UU489 era, - UU491 UU490 UU490 UU492
* Calculated from Protein Sequence

Gene ID: UU488

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
apt  

Definition:
adenine phosphoribosyltransferase

Gene Start:
585080

Gene Stop:
584559

Gene Length:
522

Molecular Weight*:
19229

pI*:
10.00

Net Charge*:
4.48

EC:
2.4.2.7  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; salvage of nucleosides and nucleotides  

Pathway: pathway table
Purine metabolism

Comment:
Involved in biosynthesis and/or salvage of purines and pyrimidines.

See Prosite PDOC00096.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to adenine phosphoribosyltransferases; e.g. residues 4-163 are 44% similar to APT_ECOLI; residues 4-163 are 45% similar to APT1_WHEAT; and residues 4-173 are 43% similar to APT_HAEIN.
BLAST reveals significant similarity to TP1039 and MG276, both of which are adenine phosphoribosyltransferases. No significant similarity to C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0503 is EHgpcmYu.
Cog name: Adenine/guanine phosphoribosyltransferases.
Functional class: F.
BeTs to e-g-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 82-86 and 115-130 are in the 99.97th percentile of similarity to blocks BL00103A,B (Purine/pyrimidine phosphoribosyl transferases proteins.)

ProDom Summary:  Protein Domain Search
Residues 100-173 are 48% similar to a defined domain of APT_DROME.
Residues 32-99 are 42% similar to a defined domain of APT2_ARATH.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 26 to 162 (E-value = 1.6e-41) place UU488 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
90

PDB Hit:
gi|5822232|pdb|1QB7|A Chain A, Crystal Structures Of Adenine Phosphoribosyltransferase From Leishmania Donovani.

Gene Protein Sequence:
MINIDYIKSKIRDVPDFPKKGIVFKDITPLFLEPKIIEKIVDDFADFAKS
LNIDAIIGAESRGFLFAAPLSIKLNKPFILVRKPNKLPNDVYSAEYTLEY
GSSRVEMHKDALKPNQRVLIVDDLLATGGTVAAIENLVRQAKGIVAGSVY
LIRLGFLKGEEKLSGKVHALINY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCAATATTGATTACATTAAATCAAAAATCAGGGATGTACCAGACTT
CCCTAAAAAAGGAATCGTTTTTAAGGATATTACTCCTTTATTTTTAGAAC
CAAAAATTATTGAAAAGATTGTTGATGATTTTGCTGACTTTGCTAAATCA
TTAAATATAGATGCTATAATAGGTGCGGAGTCGCGTGGTTTTTTGTTTGC
AGCACCATTATCAATCAAATTAAATAAGCCATTTATTTTGGTACGTAAAC
CAAATAAGTTACCAAATGATGTTTATAGTGCTGAGTACACATTAGAATAT
GGTAGTTCTCGTGTGGAGATGCACAAAGATGCACTAAAACCAAACCAACG
CGTTTTAATTGTTGATGATTTATTAGCAACAGGAGGGACTGTTGCTGCGA
TTGAAAATCTTGTTCGTCAAGCTAAAGGAATTGTAGCAGGGAGTGTTTAT
TTAATTCGTTTAGGATTTCTAAAAGGTGAAGAAAAACTAAGTGGAAAAGT
TCATGCTTTAATTAATTATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy