Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR406 IGR408 IGR407 IGR404 IGR405 mnu,nucA, - UU486 UU485 UU487 UU483 UU482 ackA, - UU484 mnu,nucA, - UU486 UU485 UU487 UU483 UU482 ackA, - UU484 Type: tandem, Name:  - 290 Type: tandem, Name:  - 287 Type: tandem, Name:  - 418 Type: tandem, Name:  - 288 Type: tandem, Name:  - 289 Type: tandem, Name:  - 291 Type: tandem, Name:  - 453 mnu,nucA, - UU486 UU485 UU487 UU483 UU482 ackA, - UU484
* Calculated from Protein Sequence

Gene ID: UU484

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ackA  

Definition:
acetate kinase

Gene Start:
576679

Gene Stop:
577842

Gene Length:
1164

Molecular Weight*:
44575

pI*:
9.30

Net Charge*:
10.14

EC:
2.7.2.1  

Functional Class:
central intermediary metabolism; other  

Pathway: pathway table
Propanoate metabolism
Pyruvate metabolism

Comment:
This enzyme, a homodimer, is involved in the interconversion of acetate and acetyl-CoA via the acetyl phosphate intermediate. In anaerobic growth it provides ATP by catabolyzing acetate phosphate into acetate.

ACK is involved in the secretion of excess carbohydrate. In its catalysis of the interconversion of acetate and acetyl phosphate it appears to favor the formation of acetate.

See Prosite PDOC00826.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to acetate kinases; e.g. residues 2-385 are 32% similar to ACKA_MYCPN; residues 77-387 are 29% similar to ACKA_CLOTS; and residues 77-376 are 30% similar to ACKA_CORGL.
BLAST also reveals significant similarity to MG357 and TP0476, both of which are acetate kinases. No significant similarity to C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0282 is Ehgpc---.
Cog name: Acetate kinase.
Functional class: C.
BeTs to ---pc---.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 2-379 span eight regions of similarity to blocks BL01075A,C-I (Acetate and butyrate kinases family proteins.)

ProDom Summary:  Protein Domain Search
Residues 2-365 are 35% similar to a defined domain of ACKA_MYCPN.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 1 to 377 (E-value = 4.3e-59) place UU484 in the Acetate_kinase family which is described as Acetokinase family (PF00871)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
194
non-globular  
295  
387

PDB Hit:


Gene Protein Sequence:
MMLIINIGSSSWKFCLFDMNLKQIFSGKIRLDVSPHQLKYIFDKNEYVYL
LDDDHNNHVDLIIKFLINKKIIKKLEDITYFGIRAVYVKNFYGASAFLNN
EIYNDLNQHTDLCPIHNQNTIMLINDIKHLNTSAKIIIIFDNWFHRSINK
NKYTIAIDQTIAIKHKIRKYGFHGISFSYSNKIMQNYLGKQDVNLIILHL
GSGSSVCAIKNGKSFDTSMSYSPLSGIIMNTRSGDIDPSVLLTLKKVKNQ
SLKQLILFLNQQSGLYGLTKHHSISEVANNLHNKNNELALEMYTDSIVDY
FIKYLNHLQKIDAIVFSGGISEFEHLVLEKIISKIHLINLEINDHLILTN
TLNKISTSKSQIPIYLCLVNEEHEIAYEMLNLINKTK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGTTAATAATTAATATTGGTAGTAGTAGTTGAAAATTTTGCTTGTT
TGATATGAATTTAAAACAAATATTTAGTGGCAAAATTCGCTTAGACGTTA
GCCCACACCAACTAAAATATATCTTTGATAAAAATGAATATGTTTATTTA
CTTGATGATGATCACAACAATCACGTTGATTTAATCATTAAATTTTTAAT
TAACAAAAAAATTATTAAAAAATTAGAAGATATCACTTATTTTGGAATTC
GAGCTGTTTATGTTAAAAATTTTTATGGAGCAAGTGCTTTTTTAAATAAT
GAAATTTATAATGATCTTAACCAACACACAGATTTATGTCCTATTCACAA
CCAAAATACTATCATGTTAATTAATGACATTAAGCATTTAAACACCTCTG
CAAAAATTATTATTATTTTTGATAATTGGTTTCATCGTAGTATTAATAAA
AATAAATACACTATTGCTATTGATCAAACAATAGCAATAAAACATAAAAT
TCGTAAATATGGTTTTCATGGAATTTCTTTTAGTTATAGTAATAAAATAA
TGCAAAATTATTTAGGAAAACAAGATGTTAATTTAATTATTTTACACTTA
GGTTCTGGATCGTCAGTTTGTGCAATTAAAAATGGAAAATCATTTGATAC
CTCAATGTCTTACTCTCCTCTTTCAGGAATTATTATGAATACAAGAAGTG
GTGATATAGACCCTAGTGTTTTACTTACTTTAAAAAAAGTAAAAAACCAA
TCACTGAAGCAATTGATCTTATTTTTAAATCAGCAATCAGGTCTTTATGG
ATTAACAAAACATCATAGTATTAGTGAAGTTGCTAATAATTTGCACAATA
AAAATAATGAACTTGCCCTTGAGATGTACACTGATAGCATTGTTGATTAT
TTTATTAAGTATTTAAACCATTTACAAAAGATTGATGCAATTGTATTTTC
GGGAGGAATTAGTGAATTTGAGCATCTTGTTTTAGAAAAAATTATTAGTA
AAATTCATCTAATAAACCTTGAAATTAACGATCATTTAATACTAACAAAC
ACGTTAAATAAAATTTCAACATCTAAATCACAAATTCCTATATATTTATG
TTTAGTGAATGAAGAGCACGAAATTGCTTATGAAATGCTAAATTTAATTA
ATAAGACAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy