Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR398 IGR400 IGR399 IGR397 IGR401 UU478 mod, - UU477 UU475 UU476 UU479 UU480 UU478 mod, - UU477 UU475 UU476 UU479 UU480 Type: tandem, Name:  - 417 Type: tandem, Name:  - 283 Type: tandem, Name:  - 284 Type: tandem, Name:  - 386 Type: tandem, Name:  - 452 UU478 mod, - UU477 UU475 UU476 UU479 UU480
* Calculated from Protein Sequence

Gene ID: UU477

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mod  

Definition:
DNA methyltransferase (probable adenine specific)

Gene Start:
549607

Gene Stop:
548525

Gene Length:
1083

Molecular Weight*:
41964

pI*:
9.40

Net Charge*:
7.33

EC:
2.1.1.72  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to methyltransferases; e.g. residues 2-259 are 36% similar to (AE000573) an adenine specific DNA methyltransferase (mod) of Helicobacter pylori 26695; residues 2-246 are 34% similar to (AE001563) type III DNA modification enzyme (methyltransferase) of Helicobacter pylori J99.
BLAST also reveals no significant similarity to M.genitalium, C.trachomatis, or T.pallidum.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 7-25 and 225-235 are in the 99.91th percentile of similarity to blocks BL00093B,C (N-4 cytosine-specific DNA methylases proteins.)

ProDom Summary:  Protein Domain Search
Residues 2-77 are 61% similar to a defined domain of O25315_XXXXX, an adenine-specific methyltransferase.
Residues 184-294 are 35% similar to a defined domain of MTK1_KLEPN, an adenine-specific methyltransferase.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 9 to 271 (E-value = 1e-17) place UU477 in the N6_N4_Mtase family which is described as DNA methylase (PF01555)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
36  
180

PDB Hit:


Gene Protein Sequence:
MMNERLKLAKNLLKNDGVIFVSIDDNEQAYLKVLMDEIFGEENFVTNFIW
QKKSGGGLNKLIYEGHEYILCYSKNNYNFCLSEKNKKMSGFIKYKDKNNN
SFFINSDIIRNNFGKKDNKFEHRNKAYEDLSKEDKEKWNLKLDNKNYILV
PFKKEPGKHLVAKIFNDERKTTYSIIKLPFTFVSGIWTKDGNNEVDSLNI
DFQNPKPIQLIMHLLDLHSNKNARVLDFFAGSGTTGHAVLELNKEDGGNR
TFTLITNNENQIGTNVCYERLYRINNGIGTKNEIDFDWVSKNKPYLNKLN
VYDLKYFDTNPIEVDNSKIKKVFAKMLVDFNNTSQSSLFENNQRELLINL
STLKPIEKKE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAACGAACGTTTAAAATTAGCTAAAAACTTACTTAAAAATGATGG
TGTAATTTTTGTATCCATTGACGATAATGAACAAGCATACTTAAAAGTTT
TGATGGATGAAATTTTTGGCGAAGAGAATTTTGTTACAAATTTTATTTGG
CAAAAGAAATCTGGTGGTGGTTTGAATAAATTAATATATGAAGGCCATGA
GTATATATTATGTTATTCAAAAAATAATTACAATTTTTGTCTTTCTGAAA
AAAATAAAAAAATGAGTGGTTTTATTAAATATAAAGATAAAAACAATAAT
TCTTTTTTTATAAATAGCGATATTATTAGAAATAATTTTGGAAAAAAAGA
TAATAAATTCGAACATAGAAACAAAGCTTATGAAGATTTATCTAAAGAAG
ATAAAGAAAAATGAAATTTAAAATTAGATAATAAAAATTATATTTTAGTT
CCATTTAAAAAAGAGCCAGGAAAGCATTTAGTAGCAAAAATATTTAATGA
TGAAAGAAAAACTACTTATAGCATAATTAAACTTCCATTTACTTTTGTGT
CAGGTATTTGAACTAAAGATGGAAATAATGAAGTTGATTCATTAAATATA
GATTTTCAAAACCCAAAACCAATTCAATTGATAATGCATTTATTAGATTT
ACATTCCAATAAAAATGCTCGTGTTTTAGATTTCTTCGCAGGATCTGGAA
CAACTGGTCATGCAGTATTAGAATTAAATAAAGAAGATGGTGGAAATCGA
ACATTCACATTAATAACAAACAATGAAAATCAAATAGGCACTAATGTTTG
TTATGAACGCTTATATCGTATCAACAATGGTATTGGAACTAAAAACGAAA
TCGATTTTGATTGAGTTAGTAAAAATAAACCATATTTAAATAAACTAAAT
GTTTATGATTTAAAATATTTTGACACTAATCCAATTGAAGTTGATAATAG
CAAGATTAAAAAAGTATTTGCTAAAATGTTAGTTGATTTTAATAATACAA
GTCAATCAAGTTTATTTGAAAATAACCAACGCGAATTATTAATTAATTTA
AGTACACTAAAACCAATTGAAAAAAAGGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy