Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR391 IGR390 IGR395 IGR393 IGR392 IGR394 UU471 UU472 Afs,pfs,deoD, - UU470 UU468 UU469 UU473 parC,gyrA, - UU467 UU474 UU471 UU472 Afs,pfs,deoD, - UU470 UU468 UU469 UU473 parC,gyrA, - UU467 UU474 Type: tandem, Name:  - 281 Type: tandem, Name:  - 278 Type: tandem, Name:  - 385 Type: tandem, Name:  - 279 Type: tandem, Name:  - 280 Type: tandem, Name:  - 282 Type: tandem, Name:  - 416 UU472 Afs,pfs,deoD, - UU470 UU468 UU469 UU473 parC,gyrA, - UU467 UU474 UU471
* Calculated from Protein Sequence

Gene ID: UU470

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
Afs  pfs  deoD  

Definition:
pfs protein (purine nucleoside phosphorylase)

Gene Start:
536299

Gene Stop:
536655

Gene Length:
357

Molecular Weight*:
13391

pI*:
7.90

Net Charge*:
1.08

EC:
2.4.2.1  2.7.-.-  

Functional Class:
uncategorized  

Pathway: pathway table
Nicotinate and nicotinamide metabolism
Purine metabolism
Pyrimidine metabolism

Comment:

See UU368, a predicted deoA sequence; UU281, a predicted deoD sequence; and UU585, a predicted deoC sequence.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to Pfs proteins; e.g. residues 2-111 are 41% similar to (AF012886) Pfs of Buchnera aphidicola; residues 2-115 are 35% similar to (U55214) Pfs of Treponema pallidum; and residues 2-111 are 33% similar to PFS_ECOLI.
BLAST also reveals significant similarity to TP0170, a pfs protein (purine nucleoside phosphorylase).
No significant similarity to M.genitalium or C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0775 is eh--c--u.
Cog name: Nucleoside phosphorylase (prediction).
Functional class: F.
BeTs to e------u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 2-111 are 41% similar to a defined domain of O51931_BUCAP, a nucleosidase.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MIGLIVALNSEIKTFFKQIKKKVYQINNIDFYLCTHQNIEFVLVFTDVGK
TNASFITALLINNFKPKVILNVGSCGALNDQLQVLDIAIIDQCQYLDVNV
SAFGYLKNQIPRLDNFLF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGGTTTAATTGTGGCATTAAATAGTGAAATTAAAACCTTTTTTAA
ACAAATTAAAAAGAAGGTTTATCAAATTAATAATATTGATTTTTACTTGT
GCACTCATCAAAATATAGAATTTGTTTTAGTTTTTACGGATGTAGGAAAA
ACTAATGCGAGTTTTATTACTGCATTATTAATTAATAATTTTAAACCTAA
AGTGATTTTAAACGTTGGTAGTTGTGGTGCACTAAATGATCAGTTACAGG
TTTTAGATATTGCCATTATTGATCAATGCCAATACTTAGATGTTAACGTT
AGCGCTTTTGGTTATTTAAAAAATCAAATACCGCGTTTAGATAATTTTTT
ATTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy