Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR389 IGR388 IGR391 IGR390 IGR386 IGR393 IGR392 IGR387 IGR394 UU464 fmt, - UU463 UU471 UU472 Afs,pfs,deoD, - UU470 pdf,def, - UU465 UU468 UU469 parE,gyrB, - UU466 UU473 parC,gyrA, - UU467 UU464 fmt, - UU463 UU471 UU472 Afs,pfs,deoD, - UU470 pdf,def, - UU465 UU468 UU469 parE,gyrB, - UU466 UU473 parC,gyrA, - UU467 Type: tandem, Name:  - 279 Type: tandem, Name:  - 416 Type: tandem, Name:  - 278 Type: tandem, Name:  - 282 Type: tandem, Name:  - 276 Type: tandem, Name:  - 415 Type: tandem, Name:  - 281 Type: tandem, Name:  - 277 Type: tandem, Name:  - 280 UU464 fmt, - UU463 UU471 Afs,pfs,deoD, - UU470 pdf,def, - UU465 UU468 UU469 parE,gyrB, - UU466 UU473 parC,gyrA, - UU467 UU472
* Calculated from Protein Sequence

Gene ID: UU467

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
parC  gyrA  

Definition:
DNA topoisomerase subunit A (gyrase A)

Gene Start:
531447

Gene Stop:
533999

Gene Length:
2553

Molecular Weight*:
97428

pI*:
7.30

Net Charge*:
2.24

EC:
5.99.1.-  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
Required for cell septation and decatenation of completed chromosomes into progeny.
(See Bailey, et al 1996 GENE 168:77-80)

The four predicted gyrase genes in U.u. are: UU081 (gyrB), UU082 (gyrA), UU466 (gyrB), and UU467 (gyrA).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to topoisomerase IV subunit A sequences; e.g. residues 13-765 are 40% similar to PARC_STAAU; residues 12-754 are 40% similar to PARC_BACSU; and residues 8-827 are 38% similar to PARC_STRPN. Also similar to: PARC_MYCPN, GYRA_HELPY, GYRA_CLOAB, and GYRA_BACSU.
BLAST also reveals significant similarity to MG204, MG004, CT189, TP0005, and CT660, all of which are defined as DNA gyrase subunit A (topoisomerase).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0188 is EHGPC-yu.
Cog name: DNA gyrase and topoisomerase IV A subunits.
Functional class: L.
BeTs to -hg-c-yu.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 20-446 span eight regions of similarity to blocks PR00521A-G (DNA gyrase/topoisomerase IV, subunit A.)

ProDom Summary:  Protein Domain Search
Residues 13-219 are 63% similar to a defined domain of PARC_MYCGE.
Residues 215-361 are 42% similar to a defined domain of PARC_STAAU.


Paralogs:  Local Blast Search
Residues 17-771 are 34% similar to UU082, a DNA gyrase (topoisomerase IV) subunit A.

Pfam Summary:  Pfam Search
Residues 32 to 479 (E-value = 5.7e-207) place UU467 in the DNA_topoisoIV family which is described as DNA gyrase/topoisomerase IV, subunit A (PF00521)
Residues 549 to 601 (E-value = 1.6e-07) place UU467 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 607 to 655 (E-value = 1.2e-07) place UU467 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 658 to 707 (E-value = 1.5e-10) place UU467 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
246  
424
coil-coil  
429  
503
non-globular  
582  
711
coil-coil  
821  
850

PDB Hit:
gi|3891992|pdb|1AB4| 59kda Fragment Of Gyrase A From E. Coli

Gene Protein Sequence:
MSVNHQKIINTPLDNIVGESYAKYAKYIIQDRALPDIRDGLKPVQRRILY
AMSELGIFYDKPYKKSARTVGEVIGKYHPHGDSSIYEAMVRMSQDWKNNL
CLLDMHGNKGSIDGDNAAAMRYTEARLSKIASVMLANLKKDVVKFSPNFD
DSEKEPSILPSLFPNLLINGATGIASGYATNIPPHNPNEVFDALIYRIDH
PDCSVEKLIEICPAPDFPTGGEIHDLNGCANAHKTGEGKFIIRACIDFKI
NDNKINQIIISSIPYETNKALIIKEIEDIIYNKEVAGLIEVRDESDAKGI
SIIIDTKKDINLENVKNYLYKKTNLEISYNTKFIAIVHRTPTLVNLSTYL
DAQINHSLDVINKVDLYDLNKILLRIEIVEGLIKCVDLIDEIIKIIRASE
SRQDAKNTLIQVFNFTNNQAEAIIMMRLHNLTRTDIFDLKNEWQTLQDEA
KTLQERINSLQVRKNYLKQKMIEFKKTFGFERKTKLFDELVKVEINEDQM
IEKQNLNLVISRDGYIKTVSKKSFESSKYDELGLKTNDILFYHNIINSHD
KILIITSKAKLINLVAHKITSMRWKDVGEHLNNYVKFDANEKVIAVYIWN
EQFKIDEYQLVLASRLNLIKRIELSELDINKNSKQISIMKLNDNDNLISA
NLIKKGHNQFIIAISKLGLALLFLVHEINCLNRLAKGIKIMKLKPNDEVS
AILITPNNGYNVQLFLERGSKCFNISELKLSKRAATPTNLYPITKKVQNV
LAAFLVAHENVFYLLDQQQKINPYYLSNPKPTKLDTKISIYENDQMITDV
VKDCFLSDEAISDFKKINMYANEFDNEMLKINKNHDDSQLELIDEEEEKK
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGTAAATCATCAAAAAATTATTAATACACCTTTAGACAACATTGT
TGGTGAAAGTTATGCAAAATATGCAAAATACATTATTCAAGATCGTGCTT
TACCTGATATTCGTGATGGTTTAAAACCTGTTCAACGACGAATTTTATAC
GCAATGAGTGAATTAGGAATCTTTTATGATAAACCTTATAAAAAATCTGC
ACGTACAGTAGGAGAAGTAATTGGTAAATATCATCCACATGGAGATTCAT
CAATTTATGAAGCAATGGTGAGAATGAGTCAAGATTGAAAAAATAATCTA
TGTTTATTAGATATGCATGGTAATAAAGGTTCAATTGATGGTGATAATGC
TGCTGCAATGCGTTATACAGAAGCTCGATTATCAAAAATTGCTAGTGTAA
TGTTAGCCAACTTAAAAAAAGATGTTGTTAAATTTAGTCCAAACTTTGAT
GATAGTGAAAAAGAGCCATCAATTTTACCATCTCTTTTTCCTAATTTGTT
AATCAATGGAGCAACAGGAATTGCTTCTGGTTATGCAACAAATATTCCTC
CTCATAACCCTAATGAAGTTTTTGATGCTTTAATTTATCGTATTGATCAT
CCAGATTGTAGTGTAGAAAAACTAATTGAAATCTGTCCTGCGCCAGATTT
TCCCACAGGTGGGGAAATCCACGATTTAAATGGATGTGCTAATGCTCACA
AAACTGGTGAAGGTAAATTTATAATTCGTGCTTGCATTGATTTTAAAATC
AATGATAATAAGATTAATCAAATTATTATTAGTTCAATCCCTTATGAAAC
AAACAAGGCTTTAATCATTAAAGAAATTGAAGATATTATTTATAATAAAG
AAGTTGCTGGATTAATCGAAGTTCGTGATGAATCTGATGCTAAGGGAATT
AGTATAATTATTGATACTAAAAAAGATATTAATTTAGAAAATGTTAAAAA
CTATTTATATAAAAAAACCAACTTGGAAATCAGCTATAATACAAAATTTA
TTGCAATTGTTCACCGAACTCCTACACTTGTAAATCTATCTACATATTTA
GATGCTCAAATTAATCATAGTTTAGATGTAATTAATAAAGTCGATTTATA
TGATCTAAACAAAATTTTGTTACGTATTGAAATTGTTGAAGGCTTAATTA
AATGCGTTGATTTAATTGATGAAATTATTAAAATTATTCGTGCTAGTGAA
TCGCGTCAAGATGCAAAAAATACTTTAATTCAAGTTTTTAATTTTACAAA
TAATCAAGCTGAAGCGATTATTATGATGCGTTTACATAATTTGACACGTA
CTGATATATTTGATTTAAAAAATGAATGACAAACGCTACAAGACGAAGCT
AAAACGCTACAAGAACGAATAAATTCACTTCAAGTTCGCAAAAATTATTT
AAAACAAAAAATGATTGAATTTAAAAAAACTTTTGGTTTTGAACGCAAAA
CAAAATTATTTGATGAATTAGTAAAAGTTGAAATAAACGAAGATCAAATG
ATCGAAAAACAAAATTTGAATTTAGTAATAAGTCGTGATGGATACATTAA
AACTGTTTCTAAAAAGTCATTTGAGTCATCTAAATATGATGAATTAGGAT
TAAAAACTAATGATATTCTTTTTTATCATAATATCATTAATTCTCATGAT
AAAATCCTAATCATTACATCAAAAGCTAAATTAATTAATTTAGTTGCTCA
TAAAATCACTTCTATGCGGTGAAAAGATGTTGGTGAACACTTAAATAATT
ATGTGAAATTTGATGCTAATGAAAAAGTTATAGCTGTTTATATATGGAAC
GAACAATTTAAAATTGATGAATATCAATTAGTTTTGGCTTCTAGATTAAA
TCTAATTAAAAGAATTGAATTAAGCGAGTTGGATATAAATAAAAATAGTA
AACAAATTAGCATTATGAAATTAAATGATAATGATAATTTAATCAGTGCT
AATTTAATCAAAAAAGGTCATAATCAATTTATTATTGCAATTTCTAAATT
AGGATTAGCCCTGCTATTTTTAGTTCATGAAATTAATTGCTTAAATCGTT
TAGCTAAAGGAATTAAAATTATGAAATTAAAACCAAATGATGAGGTTAGT
GCTATTTTAATTACTCCTAATAATGGTTATAATGTTCAACTTTTTTTAGA
ACGGGGAAGTAAGTGTTTTAATATTAGTGAATTAAAATTATCAAAACGTG
CGGCCACACCAACAAATTTATATCCAATAACAAAAAAAGTGCAAAATGTT
TTAGCAGCTTTTTTAGTTGCTCATGAAAATGTTTTTTATCTTTTAGATCA
ACAACAAAAAATAAATCCATATTACTTATCAAACCCCAAACCAACAAAAC
TAGATACTAAAATTAGTATCTATGAAAACGATCAAATGATCACTGATGTA
GTTAAAGATTGCTTTTTAAGTGATGAAGCAATTAGTGATTTTAAAAAAAT
TAATATGTACGCAAATGAATTTGATAATGAAATGCTAAAAATTAATAAAA
ATCACGATGATTCACAATTAGAATTAATTGATGAAGAGGAAGAAAAAAAA
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy