Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR384 IGR389 IGR388 IGR390 IGR385 IGR386 IGR387 UU464 UU462 fmt, - UU463 obg, - UU461 pdf,def, - UU465 UU468 UU469 parE,gyrB, - UU466 parC,gyrA, - UU467 UU464 UU462 fmt, - UU463 obg, - UU461 pdf,def, - UU465 UU468 UU469 parE,gyrB, - UU466 parC,gyrA, - UU467 Type: tandem, Name:  - 278 Type: tandem, Name:  - 275 Type: tandem, Name:  - 415 Type: tandem, Name:  - 276 Type: tandem, Name:  - 277 Type: tandem, Name:  - 279 Type: tandem, Name:  - 416 UU464 UU462 fmt, - UU463 obg, - UU461 pdf,def, - UU465 UU468 UU469 parE,gyrB, - UU466 parC,gyrA, - UU467
* Calculated from Protein Sequence

Gene ID: UU466

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
parE  gyrB  

Definition:
DNA topoisomerase subunit B (gyrase B)

Gene Start:
529513

Gene Stop:
531441

Gene Length:
1929

Molecular Weight*:
72642

pI*:
8.80

Net Charge*:
5.86

EC:
5.99.1.3  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
Required for cell septation and decatenation of completed chromosomes into progeny.
(See Bailey, et al 1996 GENE 168:77-80)

See Prosite PDOC00160.

The four predicted gyrase genes in U.u. are: UU081 (gyrB), UU082 (gyrA), UU466 (gyrB), and UU467 (gyrA).

Blast Summary:  PSI-Blast Search
Numerous highly significant hits in gapped BLAST to topoisomerase/gyrase subunit B sequences; e.g. residues 5-641 are 52% similar to PARE_BACSU; residues 3-630 are 50% similar to PARE_STRPN; and residues 3-636 are 50% similar to PARE_STAAU. Also similar to: GYRB_BACSU, GYRB_SPICI, GYRB_CLOAB, and GRYB_STRPN.
BLAST also reveals significant similarity to MG203, MG003, TP1006, CT190, and CT661, all of which are DNA gyrase/topoisomerase subunit B sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0187 is EHGPc-yu.
Cog name: DNA gyrase and topoisomerase IV B subunits.
Functional class: L.
BeTs to ---pc-yu.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 16-592 span eleven regions of similarity to blocks BL00177A-I (DNA topoisomerase II proteins.)

ProDom Summary:  Protein Domain Search
Residues 154-361 are 50% similar and residues 475-623 are 63% similar to a defined domain of Q59526_MYCGA, a topoisomerase.
Residues 3-126 are 66% similar to a defined domain of GYRB_SPICI.
Residues 353-468 are 59% similar to a defined domain of PARE_STRPN.

Paralogs:  Local Blast Search
UU081, a DNA gyrase subunit B (topoisomerase), is a possible paralog.

Pfam Summary:  Pfam Search
Residues 30 to 174 (E-value = 1e-20) place UU466 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 220 to 391 (E-value = 2.7e-69) place UU466 in the DNA_gyraseB family which is described as DNA gyrase B (PF00204)
Residues 419 to 530 (E-value = 4.7e-09) place UU466 in the Toprim family which is described as Toprim domain (PF01751)
Residues 558 to 623 (E-value = 1.8e-36) place UU466 in the DNA_gyraseB_C family which is described as DNA gyrase B subunit, carboxyl terminus (PF00986)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
138  
254
coil-coil  
374  
401

PDB Hit:
gi|3212436|pdb|1AJ6| Novobiocin-Resistant Mutant (R136h) Of The N-Terminal 24 Kda Fragment Of Dna Gyrase B Complexed With Novobiocin At 2.3 Angstroms Resolution

Gene Protein Sequence:
MANKYDGNAIKILEGLEAVRKRPGMYIGSTSSTGLHHLIWEIVDNSIDEV
MNANAKNINVILHEDNSISVLDDGRGIPVDINSQTKISTVETVLTVLHAG
GKFDESAYKTAGGLHGVGSSVVNALSSWLICEVYRDQKIYQAKFINGGHI
NQSLKVIGTTKKTGTLIHFLPDPLIFKNLVFNPNIIKERLHESTFLIKDL
KIIFEDKINKKKYEFINNQGLIDFIKFINEAKKTFSDVIYFRSNINKIDV
EIAFQYSDQNNEIMVSFANSVKTSEGGVHENAFKNALTSVVNNYARKHNL
LKEKDKNLEGDDIREGLSSVISLRIPESLISYEGQTKNKLFTPEANEAVK
KTIEDNFSFWLEENKTQALDLVNRAILARDAKLAAKRAREETKKVKKIKE
ERGMGGKLTPAQSKDPVLNELFLVEGDSAGGSAKLGRNKKYQAILPLRGK
VLNVLKARLVDVLKNEEIASIFTCLGTGIGAEFDLKKLKYHKIIIMTDAD
TDGSHIQVLLLTLFYRFMRPLIENGNIYIALPPLYKLTNKNNKKFFYAWD
DVELDQLKKEQKNYEIQRYKGLGEMNADQLFETTMDPNNRLLLKININDI
LQAERQINTLMGNDVSIRKQWIDNNIDFSVIDELQINNEESK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAATAAATACGATGGGAATGCTATTAAAATCTTAGAAGGGTTGGA
AGCTGTTCGTAAGCGTCCTGGAATGTATATTGGCTCTACAAGTAGCACTG
GATTACATCATTTAATTTGAGAAATTGTAGATAATTCAATTGATGAAGTT
ATGAATGCTAACGCAAAAAACATTAATGTTATTTTGCATGAAGATAATTC
AATTAGTGTTTTAGATGATGGGCGTGGTATACCAGTTGACATTAATTCTC
AAACAAAAATTTCTACTGTTGAAACTGTTCTAACAGTTTTGCATGCTGGA
GGTAAGTTTGATGAAAGTGCATACAAAACTGCTGGTGGTTTACATGGTGT
TGGTTCATCAGTAGTTAATGCTTTAAGTTCTTGATTAATTTGTGAAGTTT
ATCGTGATCAAAAAATTTACCAAGCGAAATTTATTAATGGAGGTCATATT
AATCAATCTTTAAAAGTAATTGGAACAACTAAAAAAACAGGAACATTAAT
TCATTTCTTACCCGATCCTCTAATTTTTAAAAATTTAGTTTTTAATCCTA
ACATAATAAAAGAGCGTCTACATGAATCAACTTTTTTAATAAAAGATTTA
AAAATTATTTTTGAAGATAAAATTAATAAAAAAAAGTACGAATTTATTAA
TAATCAAGGTTTAATTGATTTTATTAAATTTATTAATGAAGCTAAAAAGA
CCTTTTCTGATGTTATTTATTTTAGAAGTAATATTAACAAAATAGATGTT
GAAATTGCTTTTCAATATAGTGATCAAAATAATGAAATTATGGTTTCATT
TGCCAATTCTGTGAAAACTAGTGAAGGTGGTGTACACGAAAATGCTTTTA
AAAACGCTTTAACAAGTGTTGTTAATAATTATGCAAGAAAACATAATTTA
CTTAAAGAAAAAGACAAAAATTTAGAAGGTGATGATATACGTGAGGGTTT
ATCAAGTGTAATTTCACTTCGAATCCCCGAAAGCTTAATTAGCTATGAGG
GTCAAACTAAAAACAAATTATTCACACCAGAAGCAAATGAAGCAGTAAAA
AAAACAATTGAAGATAATTTTAGTTTTTGATTAGAAGAAAATAAAACACA
AGCTTTAGATTTAGTTAATCGAGCAATTCTTGCACGTGATGCTAAATTGG
CTGCAAAGCGTGCTCGTGAAGAAACTAAAAAAGTTAAAAAAATTAAAGAA
GAGCGAGGAATGGGCGGAAAATTAACGCCAGCACAAAGTAAAGATCCAGT
TTTAAATGAATTATTTTTGGTTGAAGGTGATTCAGCTGGTGGATCAGCTA
AACTAGGACGAAATAAAAAATACCAGGCTATTTTGCCCTTAAGAGGTAAG
GTTCTTAATGTTTTAAAAGCTCGTTTAGTTGATGTTTTAAAAAATGAAGA
AATAGCATCAATCTTTACTTGTTTAGGAACAGGAATTGGTGCAGAATTTG
ATTTAAAAAAATTAAAATATCATAAAATTATTATTATGACCGATGCAGAT
ACCGATGGTAGTCACATCCAAGTTTTATTATTAACTTTATTTTATCGTTT
TATGCGACCTTTAATTGAAAATGGTAATATTTACATAGCTTTACCTCCGC
TTTATAAATTAACAAATAAAAATAACAAAAAATTCTTTTATGCTTGGGAT
GATGTTGAATTAGATCAACTAAAAAAAGAGCAAAAAAATTATGAAATCCA
ACGTTATAAAGGTCTTGGCGAAATGAACGCTGATCAATTATTTGAAACAA
CAATGGATCCAAACAATCGTTTATTATTAAAAATTAATATTAATGACATT
TTACAAGCTGAACGGCAAATCAATACTTTAATGGGTAATGACGTAAGTAT
TCGAAAGCAGTGAATTGATAATAATATTGATTTTAGTGTCATTGACGAAT
TACAAATCAATAATGAGGAGTCTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy