Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR384 IGR389 IGR388 IGR383 IGR385 IGR386 IGR387 UU464 outB,nadE, - UU460 UU462 fmt, - UU463 obg, - UU461 pdf,def, - UU465 UU468 parE,gyrB, - UU466 parC,gyrA, - UU467 UU464 outB,nadE, - UU460 UU462 fmt, - UU463 obg, - UU461 pdf,def, - UU465 UU468 parE,gyrB, - UU466 parC,gyrA, - UU467 Type: tandem, Name:  - 278 Type: tandem, Name:  - 275 Type: tandem, Name:  - 416 Type: tandem, Name:  - 276 Type: tandem, Name:  - 277 Type: tandem, Name:  - 415 UU464 outB,nadE, - UU460 UU462 fmt, - UU463 obg, - UU461 pdf,def, - UU465 UU468 parE,gyrB, - UU466 parC,gyrA, - UU467
* Calculated from Protein Sequence

Gene ID: UU465

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pdf  def  

Definition:
formylmethionine deformylase (polypeptide deformylase)

Gene Start:
528910

Gene Stop:
529506

Gene Length:
597

Molecular Weight*:
23128

pI*:
7.30

Net Charge*:
1.02

EC:
3.5.1.31  

Functional Class:
translation; protein modification  

Pathway: pathway table
Glyoxylate and dicarboxylate metabolism
Methionine metabolism

Comment:
This protein removes the formyl group from the N-terminal Met of newly synthesized proteins. Enzyme requires zinc.

Reaction:
N-FORMYL-L-METHIONINE + H(2)O = FORMATE + L-METHIONINE.

There is a 3D structure for the E. coli protein.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to deformylases; e.g. residues 10-196 are 37% similar to DEF_MYCGE; residues 72-182 are 36% similar to DEF_ECOLI; and residues 72-182 are 37% similar to DEF_HAEIN.
BLAST also reveals significant similarity to MG106, CT353, and TP0757, all of which are deformylases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0242 is ehgpc--u.
Cog name: N-formylmethionyl-tRNA deformylase.
Functional class: J.
BeTs to e-g-c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 56-90, 101-116, 120-143, and 150-181 are in the 99.97th percentile of similarity to blocks PF01327A-D (Polypeptide deformylase.)

ProDom Summary:  Protein Domain Search
Residues 50-172 are 47% similar to a defined domain of DEF_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 18 to 187 (E-value = 1e-50) place UU465 in the Pep_deformylase family which is described as Polypeptide deformylase (PF01327)

PDB Hit:
gi|2098360|pdb|1DEF| Peptide Deformylase Catalytic Core (Residues 1 - 147), Nmr, 9 Structures

Gene Protein Sequence:
MYNIKFLDLLNSNLKPNPQWIFKDPHPILREVTQDIEGNELSKDDIYYLK
KMVRYIDVCYHNQAKKYKIRSGIAIAANQVGWNKRATYIHFNDEAKEHHY
LLINPHIIKRSSEIAYLNPGEGCLSVDDDRSGYVIRNKKVHVKAYDLISE
QFIDQEFSGIIAICIQHEIGHLDAGLYYDNINQQQPFYADPSWTKIGR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACAATATTAAATTTTTAGATTTATTAAATTCAAATTTAAAGCCTAA
CCCTCAATGAATTTTTAAAGATCCACATCCCATTTTACGCGAAGTAACTC
AAGATATAGAAGGTAATGAATTATCAAAAGATGATATTTATTATCTTAAA
AAAATGGTCCGTTATATTGATGTTTGTTATCATAATCAAGCCAAAAAATA
TAAAATTCGTTCAGGAATTGCGATCGCTGCAAATCAAGTTGGTTGAAACA
AACGCGCAACTTATATCCATTTTAATGATGAAGCCAAAGAACATCATTAT
TTATTAATTAATCCTCATATTATTAAACGTTCATCTGAAATAGCTTATTT
AAATCCAGGTGAAGGATGTTTATCTGTTGATGATGATCGTTCTGGATATG
TTATTAGAAATAAAAAAGTTCATGTTAAAGCATATGATCTAATTAGCGAA
CAATTTATTGATCAAGAATTTAGTGGTATTATTGCAATTTGCATCCAACA
TGAAATTGGTCATTTAGATGCTGGTTTATATTATGACAATATCAATCAAC
AGCAACCATTTTATGCCGATCCTAGTTGAACAAAGATAGGAAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy