Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR384 IGR382 IGR383 IGR381 IGR385 IGR386 IGR380 IGR387 UU464 outB,nadE, - UU460 UU462 fmt, - UU463 syfA,pheS, - UU458 obg, - UU461 syfB,pheT, - UU457 pdf,def, - UU465 rpe,ppe, - UU456 UU455 UU464 outB,nadE, - UU460 UU462 fmt, - UU463 syfA,pheS, - UU458 obg, - UU461 syfB,pheT, - UU457 pdf,def, - UU465 rpe,ppe, - UU456 UU455 Type: tandem, Name:  - 415 Type: tandem, Name:  - 273 Type: tandem, Name:  - 274 Type: tandem, Name:  - 275 UU464 outB,nadE, - UU460 UU462 fmt, - UU463 syfA,pheS, - UU458 obg, - UU461 syfB,pheT, - UU457 UU459 UU459 pdf,def, - UU465 UU455 rpe,ppe, - UU456
* Calculated from Protein Sequence

Gene ID: UU460

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
outB  nadE  

Definition:
NH(3)-dependent NAD+ synthetase

Gene Start:
524741

Gene Stop:
523974

Gene Length:
768

Molecular Weight*:
30063

pI*:
8.10

Net Charge*:
2.59

EC:
6.3.5.1  

Functional Class:
uncategorized  

Pathway: pathway table
Glutamate metabolism
Nicotinate and nicotinamide metabolism

Comment:
A sporulation protein.

Blast Summary:  PSI-Blast Search
Several significant hits of NH(3)-dependent NAD+ synthetases; e.g. residues 4-236 are 35% similar to NADE_MYCGE; residues 15-238 are 27% similar to NADE_BACSU.
BLAST also reveals significant similarity to MG383, an NH(3)-dependent NAD+ synthetase. No significant similarity to C.trachomatis or T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0171 is e-gpcmyu.
Cog name: NAD synthase.
Functional class: H.
BeTs to --g-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 27-46 and 23-58 are in the 96.83th percentile of similarity to blocks BL01263B,C (Uncharacterized protein family UPF0021 proteins.)

ProDom Summary:  Protein Domain Search
Residues 111-236 are 39% similar, and residues 4-99 are 34% similar to a defined domain of NADE_MYCGE.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 61 to 239 (E-value = 2.7e-13) place UU460 in the NAD_synthase family which is described as NAD synthase (PF02540)

PDB Hit:
gi|2392477|pdb|1NSY|A Chain A, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From Bacillus Subtilis

Gene Protein Sequence:
MNNDLIKYLQWLKNDFIKFLNDAQTNNVILGISGGIDSTLTLAILNDLKK
EYDLNIYAYFLDIHNSSLDYECINELKNIYPNIEVINLVDIYDSYCKMIN
KKTNDKYVLYNLKPKIRTNYLYAMANAYKGVVVSNLNYDEYILGFFTKYG
DSAADYYMLIGLLKKHIYELGAYYHLPNKILNRAPTPANEDDEHKTDESF
FGFTYNDLDQFLLYRKINPKIVSMIKKRYETNAHKHFVFDKKKLFLNYKL
GNKHE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAATGATTTGATTAAATATCTACAATGGTTGAAAAATGATTTTAT
AAAATTTTTAAATGACGCACAAACGAATAATGTTATTTTGGGCATTTCAG
GTGGTATTGATAGCACTTTAACATTAGCTATTTTAAATGATTTAAAAAAA
GAGTATGATCTTAATATTTATGCTTATTTTTTAGATATTCATAATTCGAG
TTTAGATTATGAATGTATTAATGAATTAAAAAATATTTATCCTAACATTG
AAGTTATCAATCTTGTTGATATCTATGATAGCTATTGTAAAATGATTAAT
AAAAAAACAAATGATAAATATGTTCTTTATAATTTAAAGCCTAAAATTCG
TACAAATTATTTATATGCAATGGCGAATGCATACAAGGGTGTTGTTGTGA
GTAATTTAAACTATGATGAGTACATTTTAGGTTTTTTTACTAAATATGGC
GATAGTGCCGCTGATTATTATATGTTAATTGGTTTACTAAAAAAACATAT
TTATGAATTAGGTGCTTATTATCATTTACCAAATAAAATTTTAAACCGTG
CTCCTACTCCAGCAAATGAAGATGATGAACACAAAACTGATGAGAGTTTT
TTTGGTTTTACATATAACGATCTTGATCAATTTTTACTTTATCGTAAAAT
TAATCCTAAAATTGTTAGCATGATTAAAAAACGTTATGAGACTAATGCTC
ATAAACATTTTGTTTTTGATAAAAAGAAATTATTTTTAAATTATAAATTA
GGAAATAAACATGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy