Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR384 IGR382 IGR383 IGR381 IGR385 IGR386 IGR380 UU464 outB,nadE, - UU460 UU462 fmt, - UU463 syfA,pheS, - UU458 obg, - UU461 syfB,pheT, - UU457 rpe,ppe, - UU456 UU455 UU464 outB,nadE, - UU460 UU462 fmt, - UU463 syfA,pheS, - UU458 obg, - UU461 syfB,pheT, - UU457 rpe,ppe, - UU456 UU455 Type: tandem, Name:  - 275 Type: tandem, Name:  - 272 Type: tandem, Name:  - 273 Type: tandem, Name:  - 274 outB,nadE, - UU460 UU462 fmt, - UU463 syfA,pheS, - UU458 obg, - UU461 syfB,pheT, - UU457 UU459 UU459 UU464 rpe,ppe, - UU456 UU455
* Calculated from Protein Sequence

Gene ID: UU458

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
syfA  pheS  

Definition:
phenylalanyl-tRNA synthetase alpha chain

Gene Start:
523504

Gene Stop:
522503

Gene Length:
1002

Molecular Weight*:
38700

pI*:
7.80

Net Charge*:
3.42

EC:
6.1.1.20  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Phenylalanine, tyrosine and tryptophan biosynthesis

Comment:
The phenylalanyl-tRNA synthetase is typically a heteroterameric molecule consisting of two alpha and two beta chains.

Reaction:
ATP + L-PHENYLALANINE + TRNA(PHE) =
AMP + PYROPHOSPHATE + L-PHENYLALANYL-TRNA(PHE).

See UU192, UU287, and UU457 for other predicted phenlyalanyl-tRNA related sequences.

The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to phenylalanyl-tRNA synthetase alpha chains; e.g. residues 1-331 are 43% similar to SYFA_MYCGE; residues 43-333 are 40% similar to SYFA_BACSU; and residues 43-331 are 35% similar to SYFA_SYNY3.
BLAST also reveals significant similarity to MG194, CT836, and TP0973, all of which are phenylalanyl-tRNA synthetase alpha chains.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0016 is ehgpcMYu.
Cog name: Phenylalanyl-tRNA synthetase alpha subunit.
Functional class: J.
BeTs to -h-pcmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 97-331 are 50% similar to a defined domain of SYFA_MYCGE.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 102 to 319 (E-value = 6.2e-125) place UU458 in the tRNA-synt_2d family which is described as tRNA synthetases class II core domain (F) (PF01409)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
55  
83

PDB Hit:
gi|2781285|pdb|1PYS|A Chain A, Phenylalanyl-Trna Synthetase From Thermus Thermophilus

Gene Protein Sequence:
MDVINLIKNLKQILRTANNERHLIELKNIFVKQHLLPLYDELKKSANKKE
MGLLINNFKQQIEFVTDQILKELNDKDDQVDLKKWTNKTLFAPFINNGHH
HILNSIIDDIASFFKKLNFEIVSGSEVVSPIYNFDHLNIDENHPARASAD
SFFINSIKMLRTHCTTTTAQFLENNVNKDIRIMSFGNVYRKDDDDATHSH
QFNQVDFVWVKEGLTVANLKWLIDSLIKYLFGQNLKTRYRLSFFPFTEPS
FEVDVQCFKCDLKGCAVCKKSTWIEIMGTGMLHENVLKAANINDIRTGMA
FGVGIDRIAMLKYEIDDIRYLYSNNFKFNAQIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATGTTATTAATCTAATTAAAAATTTAAAACAAATTTTACGAACAGC
AAATAATGAACGTCATTTGATTGAATTAAAAAATATTTTTGTTAAACAAC
ATTTATTACCACTATATGATGAATTAAAAAAAAGCGCTAATAAAAAAGAA
ATGGGTTTATTAATTAATAATTTCAAACAACAAATTGAATTTGTTACTGA
TCAAATTTTAAAAGAATTAAATGATAAAGATGATCAAGTTGATTTAAAAA
AATGAACAAATAAGACTTTGTTTGCTCCTTTTATTAATAATGGGCATCAT
CATATTCTCAATAGTATTATTGATGATATTGCATCTTTTTTTAAAAAATT
AAATTTTGAAATTGTAAGTGGTTCAGAAGTTGTTTCACCTATTTATAATT
TTGATCATTTAAATATTGATGAAAATCATCCAGCAAGAGCAAGTGCTGAT
TCTTTTTTTATTAATTCAATTAAAATGTTACGTACGCATTGCACAACTAC
AACCGCACAATTTTTAGAAAATAACGTAAACAAGGACATTAGAATTATGT
CTTTTGGTAATGTTTATCGAAAAGATGATGATGATGCAACACATAGCCAC
CAATTCAATCAAGTTGATTTTGTATGAGTTAAAGAAGGTTTAACTGTTGC
TAATTTAAAGTGATTAATTGACAGTTTGATTAAATATTTATTTGGTCAAA
ATTTAAAAACACGTTATCGTTTAAGTTTTTTTCCGTTTACTGAGCCTTCG
TTTGAAGTTGATGTTCAATGTTTTAAATGCGATTTAAAAGGGTGTGCAGT
TTGCAAAAAAAGTACATGAATTGAAATTATGGGAACTGGAATGCTACATG
AAAATGTTCTAAAAGCTGCGAATATTAACGATATTAGAACAGGGATGGCT
TTTGGTGTGGGTATTGATCGAATTGCAATGTTAAAATATGAAATTGATGA
TATTCGTTATTTATATTCAAATAATTTTAAATTTAATGCCCAAATTAAAT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy