Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR384 IGR382 IGR383 IGR381 IGR380 outB,nadE, - UU460 UU462 syfA,pheS, - UU458 obg, - UU461 syfB,pheT, - UU457 rpe,ppe, - UU456 UU455 outB,nadE, - UU460 UU462 syfA,pheS, - UU458 obg, - UU461 syfB,pheT, - UU457 rpe,ppe, - UU456 UU455 Type: tandem, Name:  - 451 Type: tandem, Name:  - 272 Type: tandem, Name:  - 273 Type: tandem, Name:  - 274 outB,nadE, - UU460 UU462 syfA,pheS, - UU458 obg, - UU461 syfB,pheT, - UU457 UU459 UU459 rpe,ppe, - UU456 UU455
* Calculated from Protein Sequence

Gene ID: UU457

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
syfB  pheT  

Definition:
phenylalanyl-tRNA synthetase beta chain

Gene Start:
522471

Gene Stop:
520153

Gene Length:
2319

Molecular Weight*:
88185

pI*:
7.70

Net Charge*:
4.76

EC:
6.1.1.20  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Phenylalanine, tyrosine and tryptophan biosynthesis

Comment:
In B.subtilis, the phe-tRNA synthetase is a tetramer composed of two alpha and two beta subunits.

See UU192, UU287, and UU458 for other predicted phenlyalanyl-tRNA related sequences.

The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to phenylalanine-tRNA synthetase beta chain sequences; e.g. residues 1-707 are 28% similar to SYFB_MYCPN; residues 31-516 are 27% similar to SYFB_BACSU; and residues 31-708 are 23% similar to SYFB_ECOLI.
BLAST also reveals significant similarities to MG195 and CT475, both of which are phenylalanine-tRNA synthetase beta chains. No significant similarity to T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0072 is ehgpcmyu.
Cog name: Phenylanyl-tRNA synthetase beta subunit.
Functional class: J.
BeTs to --g-c---.
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 55-63 and 104-121 are in the 99.97th percentile of similarity to blocks DM01195A,B (METHIONINE--TRNA LIGASE.)
Residues 161-186, 444-463, 527-553, and 691-704 are in the 99.71th percentile of similarity to blocks PD02410A,C-E (SYNTHETASE BETA CHAIN LIGASE PHENYLALANYL-TRNA.)

ProDom Summary:  Protein Domain Search
Residues 159-678 are 31% similar to a defined domain of SYFB_MYCGE.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 46 to 145 (E-value = 2.2e-11) place UU457 in the tRNA_bind family which is described as Putative tRNA binding domain (PF01588)
Residues 158 to 299 (E-value = 2.4e-51) place UU457 in the B3_4 family which is described as B3/4 domain (PF03483)
Residues 399 to 463 (E-value = 4.6e-14) place UU457 in the B5 family which is described as tRNA synthetase B5 domain (PF03484)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
208  
330
coil-coil  
540  
570
non-globular  
577  
772

PDB Hit:
gi|2781286|pdb|1PYS|B Chain B, Phenylalanyl-Trna Synthetase From Thermus Thermophilus

Gene Protein Sequence:
MILSLNLLHKISPKLKKIPLNELCAALMDLGCEVETINSIKPSTNLVFAK
VLEKTRHPNANHLNLVKVKANQKVYEIVCGANNFSVHNWVVLAKLNAELA
NGLKITPRELRGYVSNGMLCAYSEINPQATSFLTSTDLDGILVLDDNYDH
YKTPNQIFNLDDVILDLSIPSNRNDLNGYFWIAKELCAYFDFEYVVDATI
NHRPHKEIIDVRILSDDVNSYGIIEVKNIQNYILKWNTKSILINNQIKVL
NNFADNMNFLTLLTANPLHAFDARKISGQIVVKNAEEDAILLGLDQKEYL
IKKGDLIIVDDQKILALAGIIGSNDSKIDATSTTAYIECANFNPMLIANT
ARRLKINTAAAMRFSKPLTNYVTKVTLKKLLANFKSDAKLIYYFKHSVHN
VIKNKINQVSDFVGAEIDLDTAQTFLKRLGYKINKSNLITPSHRYDVLNE
FDVYEDIMKKISIQEIKPQPISFDILNFENNLAYDFEKKVSDFLVDQGLF
ECKTYNLKNQTQAHEFNFFNFKQAYEINNPTSNMRSHLKLNNLNSLLEVL
EYNQNQKNELENIFEISKINPVDSSQQTVLSIILCKPLINSKINDSLIVN
NFVTTKALLHALLTKLNIDYAYDKNHVVNELYDNNQLALINANKQVFGFI
GQLKNQVKKTYGLSNDIFIINLNLTSYLNQKQVITKVIKPSMYHDVIRDI
SVKLASDVDLNNIIANIKKIKNIRKVEISDLYIKDDGIIYTFKYYINDHL
SNLSSEQIIIIEQEVNNYLKQF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTTTAAGTTTAAATTTATTACATAAGATTAGTCCAAAACTAAAAAA
GATTCCTTTAAATGAATTATGCGCAGCTTTAATGGATTTAGGTTGTGAAG
TTGAAACAATTAATAGCATTAAACCATCTACTAATTTAGTTTTTGCTAAA
GTATTAGAAAAAACTAGACATCCTAATGCTAATCATTTAAATTTAGTTAA
AGTTAAAGCAAACCAAAAAGTTTATGAGATCGTTTGTGGTGCAAATAATT
TTAGTGTTCATAATTGAGTTGTTTTAGCAAAATTAAATGCCGAACTAGCA
AATGGTTTAAAAATTACGCCACGTGAATTAAGAGGATATGTTTCAAATGG
AATGTTATGTGCTTACAGTGAAATTAATCCACAAGCTACTAGTTTTTTAA
CATCAACAGATTTAGATGGAATTTTAGTTTTAGATGACAATTATGACCAT
TATAAAACCCCAAATCAAATTTTTAATTTAGATGATGTTATTTTAGATTT
ATCAATTCCATCAAATCGGAATGATTTAAATGGTTATTTTTGAATAGCTA
AGGAATTATGTGCTTATTTTGATTTCGAATATGTTGTTGATGCAACGATT
AATCATCGCCCACATAAAGAAATTATTGACGTGCGGATTTTATCTGATGA
TGTTAATTCGTATGGAATAATCGAGGTTAAAAATATTCAAAATTATATTT
TAAAATGGAATACTAAAAGTATATTGATTAATAATCAAATTAAAGTTCTT
AATAATTTCGCTGATAATATGAATTTTTTAACATTATTAACTGCTAATCC
ACTTCATGCATTTGATGCACGAAAAATTAGTGGTCAAATTGTTGTTAAAA
ATGCTGAAGAAGATGCAATTTTATTGGGTTTAGATCAAAAAGAATATTTA
ATTAAAAAAGGGGATCTAATTATCGTTGATGATCAAAAAATTTTAGCACT
TGCTGGAATTATTGGTTCTAATGATTCTAAAATTGATGCAACAAGCACAA
CTGCTTATATTGAATGTGCAAATTTTAATCCTATGTTGATTGCAAATACA
GCGCGTCGTTTAAAAATCAATACCGCAGCGGCTATGCGTTTTAGCAAACC
CTTAACTAATTATGTTACAAAAGTAACATTAAAAAAATTGTTAGCTAATT
TTAAATCAGATGCAAAATTAATTTATTATTTTAAACATTCAGTTCATAAT
GTCATTAAAAATAAAATTAATCAAGTAAGTGATTTTGTGGGTGCAGAAAT
TGATTTAGACACTGCTCAAACATTTTTAAAACGCTTAGGTTATAAAATTA
ATAAGTCTAATTTAATTACTCCAAGTCATCGATATGATGTATTAAATGAG
TTTGATGTTTATGAAGATATTATGAAAAAAATTAGTATTCAAGAAATCAA
ACCACAACCAATCAGTTTTGATATTTTAAATTTTGAAAATAATCTAGCTT
ATGATTTTGAAAAAAAAGTTAGTGATTTTTTAGTTGATCAAGGTTTGTTT
GAGTGTAAAACTTATAATTTAAAAAATCAAACACAAGCACATGAGTTTAA
TTTTTTTAATTTTAAACAAGCTTATGAAATTAATAATCCAACTTCAAATA
TGCGTTCGCATTTAAAATTAAATAACCTTAACTCCTTACTTGAAGTATTA
GAATATAACCAAAACCAAAAAAATGAATTAGAAAATATCTTTGAGATTTC
AAAGATTAATCCAGTTGATTCAAGTCAACAAACAGTTTTATCAATCATTT
TATGTAAACCATTAATTAATTCAAAAATTAATGATTCATTAATAGTTAAT
AATTTTGTGACAACAAAAGCTTTACTACATGCTTTATTAACAAAATTAAA
TATTGATTATGCATATGATAAAAATCATGTTGTTAATGAATTATATGATA
ATAACCAATTAGCTTTAATTAATGCAAACAAACAAGTATTTGGTTTTATT
GGTCAACTAAAAAATCAAGTCAAAAAAACATATGGTTTAAGTAATGATAT
TTTTATTATTAATTTAAATTTAACTAGTTATTTAAATCAAAAACAAGTAA
TCACTAAAGTTATTAAGCCAAGTATGTATCATGATGTCATACGTGATATT
AGTGTTAAATTAGCTTCTGACGTTGACTTAAATAATATAATTGCTAATAT
TAAAAAAATTAAAAATATTAGAAAAGTTGAAATCAGCGATCTTTATATAA
AAGATGATGGAATTATTTATACTTTTAAATATTATATTAATGATCATTTA
TCTAATTTAAGTAGTGAACAAATTATAATCATTGAACAAGAAGTAAATAA
TTATTTGAAACAATTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy