Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR382 IGR381 IGR380 IGR379 outB,nadE, - UU460 syfA,pheS, - UU458 nisH,nifS, - UU454 syfB,pheT, - UU457 rpe,ppe, - UU456 UU455 outB,nadE, - UU460 syfA,pheS, - UU458 nisH,nifS, - UU454 syfB,pheT, - UU457 rpe,ppe, - UU456 UU455 Type: tandem, Name:  - 451 Type: tandem, Name:  - 272 Type: tandem, Name:  - 273 Type: tandem, Name:  - 274 outB,nadE, - UU460 syfA,pheS, - UU458 nisH,nifS, - UU454 syfB,pheT, - UU457 UU459 UU459 rpe,ppe, - UU456 UU455
* Calculated from Protein Sequence

Gene ID: UU456

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpe  ppe  

Definition:
D-ribulose-5-phosphate 3 epimerase

Gene Start:
519367

Gene Stop:
520026

Gene Length:
660

Molecular Weight*:
25916

pI*:
8.40

Net Charge*:
3.36

EC:
5.1.3.1  

Functional Class:
energy metabolism; sugars; pentose phosphate pathway  

Pathway: pathway table
Carbon fixation
Pentose and glucuronate interconversions
Pentose phosphate cycle

Comment:
This enzyme coverts D-ribulose-5-phosphate to D-xylulose.

See Prosite PDOC00833.

From Prosite:

Ribulose-phosphate 3-epimerase (EC 5.1.3.1) (also known as pentose-5-phosphate
3-epimerase or PPE) is the enzyme that converts D-ribulose 5-phosphate into
D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle. In
Alcaligenes eutrophus two copies of the gene coding for PPE are known [1],
one is chromosomally encoded (cbbEC), the other one is on a plasmid (cbbeP).
PPE has been found in a wide range of bacteria, archebacteria, fungi and
plants.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ribulose-5-phosphate 3-epimerases; e.g. residues 3-205 are 29% similar to (AE000716) ribulose-5-phosphate 3-epimerase of Aquifex aeolicus; residues 7-198 are 26% similar to RPE_SPIOL; and residues 32-198 are 29% similar to RPE_MYCTU.
BLAST also reveals significant similarity to MG112, TP0945, and CT121, all of which are D-ribulose-5-phosphate 3 epimerases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0036 is Ehgpcmyu.
Cog name: Pentose-5-phosphate-3-epimerase.
Functional class: G.
BeTs to -h-pcmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 5-202 span five regions of similarity to blocks BL01085A-E (Ribulose-phosphate 3-epimerase family proteins.)

ProDom Summary:  Protein Domain Search
Residues 5-202 are 38% similar to a defined domain of Y112_MYCGE.
Residues 86-198 are 32% similar to a defined domain of RPE_MYCTU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 4 to 204 (E-value = 2.8e-33) place UU456 in the Ribul_P_3_epim family which is described as Ribulose-phosphate 3 epimerase family (PF00834)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
140  
219

PDB Hit:
gi|4930130|pdb|1RPX|A Chain A, D-Ribulose-5-Phosphate 3-Epimerase From Solanum Tuberosum Chloroplasts

Gene Protein Sequence:
MNKQLVPSLLAFDKKYPYEQLKIFKKHHLQTIHYDVMDLTYVNNTAFETE
HLEWLLKNDFLVHIHLMVINPLEKIKQYFIYKPTRISFHFEMNDYQTNLL
IINEIKKHHVLAGIAIHPCLSLNDYASYLKEVDYITFMSVIPGKGGQIFL
EESLLKLKKLYEYKIKNNFKFKIEIDGGITLEVIKKINIPIDFFVSGSYL
VKNIEKLEQTVNEFNQLVN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAGCAACTAGTTCCATCCCTTTTAGCATTTGATAAAAAATATCC
TTATGAACAATTAAAGATCTTTAAAAAGCATCATCTTCAAACAATACATT
ATGATGTTATGGATCTAACATATGTTAATAACACTGCTTTTGAAACTGAA
CATTTAGAATGGCTACTAAAAAATGATTTTTTAGTACACATTCATCTAAT
GGTTATTAACCCTTTAGAAAAAATTAAACAATATTTTATATATAAACCAA
CTCGCATATCTTTTCATTTTGAAATGAATGATTATCAAACTAATTTATTA
ATCATTAATGAAATTAAAAAACATCATGTTTTAGCAGGGATTGCAATTCA
TCCTTGTTTATCACTAAACGATTATGCTTCTTATTTAAAAGAAGTTGATT
ATATTACTTTTATGTCGGTTATTCCAGGTAAGGGTGGACAAATTTTTTTA
GAAGAAAGTTTATTAAAACTAAAAAAATTATATGAATATAAAATTAAAAA
TAATTTCAAATTTAAGATTGAAATTGATGGTGGTATTACTTTAGAAGTTA
TTAAAAAAATCAATATTCCAATTGATTTTTTTGTAAGCGGTTCTTATTTA
GTGAAAAATATTGAAAAACTAGAGCAAACTGTTAACGAATTTAATCAACT
TGTTAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy