Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR378 IGR375 IGR374 IGR376 IGR377 IGR379 ruvB, - UU448 UU451 UU450 nisH,nifS, - UU454 proS,syp, - UU452 UU447 UU455 ruvB, - UU448 UU451 UU450 nisH,nifS, - UU454 proS,syp, - UU452 UU447 UU455 Type: tandem, Name:  - 271 Type: tandem, Name:  - 272 Type: tandem, Name:  - 451 ruvB, - UU448 UU451 UU450 nisH,nifS, - UU454 proS,syp, - UU452 nifU, - UU453 ruvA, - UU449 nifU, - UU453 ruvA, - UU449 UU447 UU455
* Calculated from Protein Sequence

Gene ID: UU452

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
proS  syp  

Definition:
prolyl-tRNA synthetase

Gene Start:
514081

Gene Stop:
512663

Gene Length:
1419

Molecular Weight*:
54359

pI*:
7.20

Net Charge*:
1.11

EC:
6.1.1.15  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Arginine and proline metabolism

Comment:
See Prosite PDOC00363.

The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous significant hits to prolyl-tRNA synthetases; e.g. residues 8-472 are 37% similar to SYP_MYCGE; residues 11-472 are 36% similar to SYEP_HUMAN; and residues 4-436 are 35% similar to YHI0_YEAST. Also similar to: SYP_METTH, SYP_METJA, SYP_ARCFU, SYT_RICPR, SYT_HAEIN, and SYP_HAEIN.
BLAST also reveals significant similarity to MG283 (prolyl-tRNA synthetase); residues 8-472 are 37% similar.
Lesser similarity to TP0837, CT729, CT581, and CT393, all of which are aminoacyl-tRNA synthetases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0442 is ehgpcmYu.
Cog name: Prolyl-tRNA synthetase.
Functional class: J.
BeTs to --g--myu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Only hits correspond to short stretches and are probably spurious.

ProDom Summary:  Protein Domain Search
Residues 14-255 are 49% similar to a defined domain of O51363_BORBU, an aminoacyl-tRNA synthetase.
Residues 261-381 are 38% similar to a defined domain of SYP_METJA, an aminoacyl-tRNA synthetase.


Paralogs:  Local Blast Search
Possibly paralogous to UU106, a seryl-tRNA synthetase.
Residues 88-286 are 23% similar.

Pfam Summary:  Pfam Search
Residues 36 to 194 (E-value = 5.9e-25) place UU452 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 290 to 382 (E-value = 1.1e-14) place UU452 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

PDB Hit:
gi|5107656|pdb|1QF6|A Chain A, Structure Of E. Coli Threonyl-Trna Synthetase Complexed With Its Cognate Trna

Gene Protein Sequence:
MSKKLEKITTRKENFADWYTSIVNNAKLIQYTDIKGMMVFQPNAWAIWEA
IKNQIDVEFKKHGVRNLAMPTLIPLSEFQKEKDHIEGFAPELFMVNQIGD
KKLDNSYAIRPTSEILFCNYFKNIVNSYNDLPIKNNQWCSVMRAEKTTRP
FLRNAEFHWQELHAIFASENEADSFAKVILDVYTDFVQNYLCIPVIKGLK
TPWERFAGAQKTYTIEAMMQDGQALQSATSHYLGQFFAKAYDIKFQGQDN
QMHYVHQMSAGLSTRIIGALIMVHADDQGLILPPDIAFNQIAILTIFSNK
NPQLLKISQQICEQLNNYRLFEDHSDKGIGYKLAQQEIEGTPICILVGAK
ELVNQQVVIVRRDTHEKINVDLTDLKLIIPKLLADIKRNIYEKAKKDLED
SIVFVNNIEELKQVIAQNKMAKAFFDGTKEDDEQIKLLTNASTRCIFDET
QNGQCFYTNKKTNKLTLFARAY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAAAAAATTAGAAAAGATTACAACAAGAAAAGAAAATTTTGCTGA
TTGATATACAAGTATTGTAAATAATGCAAAATTAATTCAGTACACTGATA
TTAAAGGAATGATGGTTTTTCAACCAAATGCTTGAGCAATTTGAGAAGCA
ATTAAAAACCAAATTGATGTCGAATTTAAAAAACACGGAGTACGCAATCT
TGCCATGCCAACTTTAATTCCTTTAAGTGAATTTCAAAAAGAAAAAGATC
ATATTGAAGGTTTTGCTCCTGAATTATTTATGGTTAATCAAATTGGTGAT
AAAAAATTAGATAATTCTTATGCAATACGTCCTACGAGTGAAATTTTATT
TTGTAATTATTTTAAAAATATTGTTAATAGTTATAATGATTTACCGATTA
AAAATAATCAATGGTGTTCAGTAATGCGTGCTGAAAAAACAACACGTCCA
TTTCTTCGAAATGCTGAGTTTCATTGACAAGAATTACATGCTATTTTTGC
AAGTGAAAATGAGGCCGATTCTTTTGCTAAAGTAATTTTAGATGTGTATA
CAGATTTTGTTCAAAATTATTTGTGTATACCTGTTATTAAAGGATTAAAA
ACACCATGAGAACGTTTTGCTGGTGCTCAAAAAACATATACAATTGAAGC
TATGATGCAAGATGGCCAAGCATTACAATCTGCAACAAGTCATTATTTAG
GGCAGTTTTTTGCAAAAGCTTATGATATTAAGTTTCAAGGTCAAGATAAT
CAAATGCATTATGTACATCAAATGTCTGCTGGATTATCAACACGAATTAT
TGGAGCATTAATTATGGTTCATGCTGATGATCAGGGTTTGATTTTGCCCC
CTGATATTGCTTTTAATCAAATTGCTATTTTAACGATTTTTTCTAATAAA
AATCCCCAATTATTAAAAATTAGTCAACAGATTTGTGAACAATTAAATAA
TTATCGTTTGTTTGAAGATCATAGTGATAAAGGAATTGGTTATAAATTAG
CACAACAAGAAATTGAGGGAACGCCTATTTGTATATTAGTTGGTGCTAAA
GAATTAGTTAATCAACAAGTTGTTATTGTGCGTCGTGATACTCATGAAAA
AATTAATGTTGATTTAACTGATTTGAAACTAATCATCCCAAAATTATTAG
CAGATATTAAAAGAAATATTTATGAAAAGGCAAAAAAAGATTTAGAGGAT
TCGATTGTTTTTGTAAATAATATCGAGGAATTAAAACAAGTTATTGCACA
AAATAAAATGGCTAAGGCATTCTTTGATGGTACAAAAGAAGATGATGAAC
AAATTAAATTATTAACTAATGCTTCAACACGTTGTATTTTTGATGAAACT
CAAAACGGGCAGTGTTTTTATACAAATAAAAAAACAAACAAATTGACTTT
ATTTGCACGTGCTTATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy