Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR358 IGR353 IGR361 IGR355 IGR360 IGR359 IGR357 IGR354 IGR356 UU425.1 ure2,ureB, - UU433 UU427 ureG, - UU429 ureF, - UU430 ureD, - UU428 ure1,ureC, - UU432 UU426 UU424 UU425 hrcA, - UU421 UU425.1 ure2,ureB, - UU433 UU427 ureG, - UU429 ureF, - UU430 ureD, - UU428 ure1,ureC, - UU432 UU426 UU424 UU425 hrcA, - UU421 Type: tandem, Name:  - 264 Type: tandem, Name:  - 261 Type: tandem, Name:  - 262 Type: tandem, Name:  - 263 Type: tandem, Name:  - 265 UU425.1 UU427 ureG, - UU429 ureF, - UU430 ureD, - UU428 ure1,ureC, - UU432 ureE, - UU431 ureE, - UU431 UU426 UU424 UU425 hrcA, - UU421 UU422 UU423 UU422 UU423
* Calculated from Protein Sequence

Gene ID: UU427

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
urease complex component

Gene Start:
490704

Gene Stop:
490192

Gene Length:
513

Molecular Weight*:
19868

pI*:
6.40

Net Charge*:
-2.36

EC:
3.5.1.5  

Functional Class:
central intermediary metabolism; other  

Pathway: pathway table
Purine metabolism
Urea cycle and metabolism of amino groups

Primary Evidence:
Ruifu Y, Minli Z, Guo Z, Wang X. 1997. Biovar diversity is reflected by variations of genes encoding urease of Ureaplasma urealyticum. Microbiol Immunol 41(8):625-7. Medline: 9310943.

MacKenzie CR, Henrich B, Hadding U. 1996. Biovar-specific epitopes of the urease enzyme of Ureaplasma urealyticum. J Med Microbiol
45(5):366-71. Medline: 8918953.

Nagata K, Takagi E, Satoh H, Okamura H, Tamura T. 1995. Growth inhibition of Ureaplasma urealyticum by the proton pump inhibitor lansoprazole: direct attribution to inhibition by lansoprazole of
urease activity and urea-induced ATP synthesis in U. urealyticum.
Antimicrob Agents Chemother 39(10):2187-92. Medline: 8619564.

Smith DG, Russell WC, Ingledew WJ, Thirkell D. 1993. Hydrolysis of urea by Ureaplasma urealyticum generates a transmembrane potential
with resultant ATP synthesis. J Bacteriol. 175(11):3253-8. Medline: 8501029.

Scheurlen W, Frauendienst G, Schrod L, von Stockhausen HB. 1992.
Polymerase chain reaction-amplification of urease genes: rapid
screening for ureaplasma urealyticum infection in endotracheal
aspirates of ventilated newborns. Eur J Pediatr 151(10):740-2. Medline: 1425793.

Willoughby JJ, Russell WC, Thirkell D, Burdon MG. 1991. Isolation and detection of urease genes in Ureaplasma urealyticum. Infect Immun. 59(7):2463-9. Medline: 2050410.

Thirkell D, Myles AD, Precious BL, Frost JS, Woodall JC, Burdon MG, Russell WC. 1989. The urease of Ureaplasma urealyticum. J Gen Microbiol. 135 ( Pt 2):315-23. Medline: 2482331.

Blanchard A. 1990. Ureaplasma urealyticum urease genes; use of a UGA tryptophan codon. Mol Microbiol. 4(4):669-76. Medline: 2191184.

Eng H, Robertson JA, & Stemke GW. 1986. Properties of urease from Ureaplasma urealyticum: kinetics, molecular weight, and demonstration of multiple enzyme isoelectric point forms. Can J Microbiol. 32(6):487-93. Medline: 3730958.

Secondary Evidence:
Neyrolles O, Ferris S, Behbahani N, Montagnier L, Blanchard A. 1996. Organization of Ureaplasma urealyticum urease gene cluster and expression in a suppressor strain of Escherichia coli. J Bacteriol. 178(9):2725.
Medline: 8626347.

Blanchard A, Barile MF. 1989. Cloning of Ureaplasma urealyticum DNA sequences showing genetic homology with urease genes from gram-negative bacteria. Res Microbiol 140(4-5):281-90. Medline: 2799066.

Comment:
See UU427-UU434.

From Neyrolles. et al., 1996:
The urease gene cluster from a biotype 1 representative of U. urealyticum (serotype I) was cloned and sequenced. Seven genes were found, with ureA, ureB, and ureC encoding the structural subunits and ureE, ureF, ureG, and a truncated ureI) gene encoding accessory proteins. Urease expression was not obtained when the plasmid containing these genes was incorporated into an opal suppressor strain of Escherichia coli, although this enzymatic activity was found in the same E. coli strain transformed with pC6b, a plasmid with previously cloned urease genes from the U. urealyticum T960 strain of biotype 2 (serotype 8). Although there are 12 TGA triplets encoding tryptophan within urease genes, the level of expression obtained was comparable to the levels reported for other bacterial genes expressed in E. coli. Nested deletion experiments allowed us to demonstrate that ureD is necessary for urease activity whereas another open reading frame located downstream is not. The promoter for ureA and possibly other urease genes was identified for both serotypes.

From: Molecular Biology and Pathogenicity of Mycoplasmas, Microbiology and Molecular Biology Reviews, Dec. 1998, p.1118-1119. Shmuel Razin, David Yogev, and Yehudith Naot.

Ureaplasmas are unique among the mollicutes in possessing a very potent urease. Although protein and gene analysis of the ureaplasmal urease complex has shown that it resembles other procaryotic ureases in subunit structure and composition, the specific activity of the ureaplasmal urease is much higher and was estimated to exceed that of jack bean urease by about 100-fold. More importantly, ureaplasmas appear to be unique among procaryotes in requiring urea for growth. [...] The dependence of ureaplasmas on urea for growth has led to the hypothesis that intracellular urea hydrolysis and the resulting intracellular accumulation of ammonia/ammonium ions is coupled to ATP synthesis through a chemiosmotic type of mechanism. Experimental support for the generation of a transmembrane potential, with resultant ATP synthesis through the ureaplasmal F0F1-type ATPase, first provided by Romano et al. (1986, Medline: 3797330) was more recently extended and confirmed by Smith et al., 1993 [...] It is worth mentioning at this point that the pH of the urogenital tract is usually on the acidic side of neutrality, corresponding to the pH values optimal for ureaplasma growth, maximum increase in delta P, maximum ammonia chemical potential, maximum urease activity, and maximum ATP generation.

For reviews of ureases, see Collins, C. and D'Orazio, S. (1993), Medline: 7934918 and Mobley, H. et al. (1995), Medline: 7565414.

Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST: residues 1-162 of UU427 are 87% similar to a predicted urease from Ureaplasma urealyticum (1204037).

No significant similarity to C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, or T. pallidum.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-162 are 87% similar to a defined domain of Q56564_UREUR, a urease.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MVKSQKVIDVLNTHYNLNLELGSIYAQYAHIADDQFSMPFLAKFIADLSN
DKLGVHKNLISEYARKVEIPLHTKFSVDVNFKPANPKELIKHILDTELKV
RKHVANMAKVCLEENDFETFSFVKWFVDDGIKDFDDVRTIHDFFENATNN
LQVEYAIRKYLKQMKVEEEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTAAATCTCAAAAAGTTATAGATGTTTTAAATACACATTATAATTT
AAATTTAGAACTAGGTAGTATTTATGCACAATATGCTCATATTGCTGATG
ACCAATTCAGTATGCCTTTTTTAGCAAAATTTATTGCTGATTTAAGCAAT
GATAAATTAGGTGTTCACAAGAATTTAATTTCTGAATATGCTCGTAAAGT
TGAAATTCCATTACACACTAAATTTAGTGTAGATGTTAATTTTAAGCCAG
CGAATCCTAAGGAATTAATAAAACACATTTTAGATACAGAATTAAAAGTT
CGTAAGCATGTAGCCAATATGGCAAAAGTATGTTTGGAAGAAAATGATTT
TGAAACATTTAGTTTTGTAAAATGATTTGTTGATGATGGTATTAAAGATT
TTGATGATGTTCGTACCATCCATGATTTCTTTGAAAATGCTACTAATAAT
TTGCAAGTTGAATATGCCATTCGTAAATATTTAAAGCAAATGAAAGTTGA
AGAAGAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy