Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-2 IGR349 IGR351 IGR346 IGR348 IGR350 IGR352 IGR347 UU416 fpg, - UU413 PolI,polA,Dp01, - UU414 UU417 thiI, - UU418 dnaE, - UU415 UU420 gcp, - UU411 metK, - UU412 UU416 fpg, - UU413 PolI,polA,Dp01, - UU414 UU417 thiI, - UU418 dnaE, - UU415 UU420 gcp, - UU411 metK, - UU412 Type: tandem, Name:  - 259 Type: tandem, Name:  - 256 Type: tandem, Name:  - 257 Type: tandem, Name:  - 258 UU416 fpg, - UU413 PolI,polA,Dp01, - UU414 UU417 thiI, - UU418 dnaE, - UU415 UU419 UU419 UU420 gcp, - UU411 metK, - UU412
* Calculated from Protein Sequence

Gene ID: UU415

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaE  

Definition:
DNA polymerase III alpha chain

Gene Start:
480900

Gene Stop:
477991

Gene Length:
2910

Molecular Weight*:
112341

pI*:
7.40

Net Charge*:
3.04

EC:
2.7.7.7  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Comment:
UU019 is a predicted delta coding sequence. UU377 and UU415 appear to be alpha subunits, although UU377 could serve as an epsilon subunit. UU087 is a predicted gamma-tau subunit sequence.

The complete list of dna() genes in U.u. are: UU001, a predicted dnaA sequence; UU019, a predicted dnaH sequence; UU079, a predicted dnaN sequence; UU087, a predicted dnaX sequence; UU339, a predicted dnaK sequence; UU407, a predicted dnaJ sequence; UU415, a predicted dnaE sequence; UU494, a predicted dnaG sequence; and UU550, a predicted dnaB sequence.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to pol III alpha chain sequences: residues 2-855 are 35% similar to the alpha chain sequence of B.subtilis (Z99118). Best hits are to alpha chain sequences; no patent similarity to epsilon sequences. UU415 is also similar to MG261, TP0669, and CT545, predicted alpha chain sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0587 is ehGPC--u.
Cog name: DNA-dependent DNA polymerase III alpha chain.
Functional class: L.
BeTs to e--pc--u.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 252-789 span eight regions of similarity to blocks PD02001A-F, which encompass DNA pol III alpha chain sequences, e.g. DP3A_MYCTU, DP3A_HELPY.

ProDom Summary:  Protein Domain Search
Residues 321-664 are 44% similar to a pol III domain of O34623_BACSU.
Residues 667-942 are 32% similar to a stretch of O67125_AQUAE.
Residues 114-287 are 29% similar to a domain of O34623_BACSU.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 3 to 68 (E-value = 3.3e-18) place UU415 in the PHP_N family which is described as PHP domain N-terminal region (PF02231)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
134  
285
non-globular  
378  
430
non-globular  
475  
534
non-globular  
627  
969

PDB Hit:


Gene Protein Sequence:
MFINLNVHSHYSLLNSTLSIDDLIKYALDNKQPYVCLTDLNNMYGCIEFY
DKAKAHNLTPIIGLEFEYQNATLVAYAKNYNGYLKLIKWSSWIMTSKEFE
IQDDFDDLIIVCKKGTIVFKSPNFYQTHDQNAPNAIALQSVFYANKNDKI
VFLAMLAIKNDLKLEDFKNCCDFDNNHFLNDNLAQSFFSPIALNNLNKVL
NELKVQIHDLPINIPVYDKQNSIISSEILKQLCISGLKKRLNANDGQVNK
IYVQRLKYELDVINEKQFDDYFLIVYDFINFAKSNGIIVGPGRGSAAGSL
VAYCLHITDIDPIKHNLIFERFLNPTRKSMPDIDTDIMDEKRDLVIEYLF
EKYGNDHVAYILTFQRLKAKMAIRDVGRILGIDLKVIDKICKNIKPEYDE
DLDLAIKKNTILKEMYLLHKELFEISKKLINAPRQIGTHAAGIILSDSLI
SNIIPIQLGINDRPLSQYSMEYLERFGLIKMDLLGLKNLTIIDNVLKMIY
ENQNKKIDLFNINYNDKFVFEDLAKARTNGIFQLESPGMKKVLLKVKPQN
IEDISIVSALFRPGPQQNIKTFVERRFKREEFSYWNEATRKILEPTYGII
VYQEQVIELVKTIANFDIATSDNFRRAISKKDEKILIQLKDDFINGALNN
NYKQPLVNQIFEYIFSFAHYGFNHSHSLAYSYISYWLAYLKHYYTLEFLS
VLLSHTSASKDKLLSYLNEAKEFNISIKGPDIQYFSNDFVIDTQKQIIRF
GFKTIKGFGDELLKKIKSALQKSTLSDYISYIDALKKGNVSLKNIEILIR
VGTFDSFGINRLFLLNNLNEIFEKTGLNGHFFDLNLVGLDYAKDMSVNDR
YLDDEIQYLGIDLNSLNYANYKTEIDYNKLKYTIKDFYEINTNYETNILA
QVLNIKQSKTKNGNDIFYLETLIDNKKQTLTIFQNSKYLIDEISIGGIYV
FGVKLLNHFNFIVNIKQRI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTATTAATTTAAATGTGCATTCACATTATTCTTTACTTAATAGTAC
TTTAAGTATTGATGATTTAATTAAATACGCATTAGATAACAAACAACCAT
ACGTTTGCTTAACTGATTTAAATAATATGTATGGCTGTATCGAATTTTAT
GATAAAGCAAAAGCACATAATTTAACTCCTATTATCGGATTAGAATTTGA
ATATCAAAATGCTACTTTAGTAGCTTATGCTAAAAATTATAATGGCTATT
TAAAATTAATCAAATGATCATCTTGAATTATGACAAGTAAAGAATTTGAA
ATTCAAGATGATTTTGATGACTTAATTATTGTTTGTAAAAAAGGAACTAT
AGTTTTTAAGAGTCCTAATTTTTATCAAACGCATGATCAAAATGCTCCTA
ATGCGATTGCATTACAAAGTGTTTTCTATGCTAACAAAAATGATAAAATT
GTTTTTTTAGCAATGTTAGCAATCAAAAATGATTTAAAGTTAGAAGATTT
TAAAAATTGTTGCGATTTTGATAATAATCATTTTCTAAATGATAATCTAG
CACAATCATTTTTTTCACCAATTGCTTTAAATAATTTAAATAAAGTTTTA
AATGAATTAAAAGTACAAATTCATGATTTACCAATTAATATTCCGGTTTA
TGATAAACAAAATTCAATTATTTCAAGTGAAATTTTAAAACAATTATGTA
TTAGCGGATTAAAAAAACGCTTAAATGCTAACGATGGCCAAGTTAATAAA
ATTTATGTTCAAAGATTAAAATATGAATTAGATGTTATTAATGAAAAACA
ATTTGATGATTATTTTTTAATTGTTTATGATTTTATTAATTTTGCTAAAA
GTAATGGTATCATTGTAGGGCCAGGACGTGGGAGTGCTGCTGGTTCGTTA
GTAGCTTATTGTTTACATATTACAGATATTGATCCTATTAAACATAATTT
AATTTTTGAACGTTTTTTAAATCCTACCAGAAAAAGTATGCCAGATATTG
ATACTGATATTATGGATGAAAAACGCGATCTAGTTATTGAATATTTATTT
GAAAAATATGGCAATGATCATGTTGCTTACATTTTAACGTTTCAACGTTT
AAAAGCGAAGATGGCTATTCGAGATGTAGGGCGGATTTTGGGAATTGATT
TAAAAGTAATTGATAAAATTTGTAAAAATATTAAACCTGAATATGATGAA
GATCTTGATTTAGCAATTAAAAAAAATACGATTTTAAAAGAAATGTATCT
TTTGCATAAAGAGTTGTTTGAAATTTCTAAAAAATTAATTAATGCTCCTC
GCCAAATAGGCACACACGCTGCAGGGATAATTTTAAGTGATAGTTTAATT
TCAAATATTATTCCAATTCAACTAGGTATTAATGACCGTCCTTTATCACA
ATATTCAATGGAATATTTAGAGCGTTTTGGTTTAATTAAAATGGATTTAT
TAGGTTTGAAAAATTTAACAATTATTGATAATGTTTTAAAAATGATTTAT
GAAAATCAAAATAAAAAAATTGATCTCTTTAACATTAACTATAATGATAA
ATTTGTCTTTGAAGATTTAGCTAAAGCAAGGACAAACGGAATATTTCAAC
TAGAATCGCCCGGAATGAAAAAAGTACTATTAAAGGTCAAACCTCAGAAT
ATTGAAGATATTTCTATTGTTTCAGCTCTTTTTCGTCCTGGTCCACAACA
AAATATTAAAACATTTGTTGAACGTCGTTTTAAACGTGAAGAGTTTAGTT
ATTGAAACGAAGCCACAAGGAAAATTTTAGAACCAACTTATGGAATTATT
GTTTATCAAGAGCAAGTGATTGAATTAGTTAAAACTATTGCAAATTTTGA
TATTGCTACTTCCGATAATTTTCGCCGTGCAATATCAAAAAAAGATGAAA
AAATTTTAATCCAATTAAAAGATGATTTTATCAATGGTGCTTTGAATAAT
AATTATAAACAACCATTGGTTAATCAAATTTTTGAATATATTTTTTCGTT
TGCACATTATGGTTTTAACCATTCACATTCACTAGCATATTCATATATTA
GTTATTGATTAGCGTATTTAAAACATTATTATACATTAGAATTTTTAAGT
GTATTATTATCACATACTAGTGCATCAAAAGATAAATTATTATCATACTT
AAATGAAGCAAAAGAATTTAATATTAGTATCAAGGGCCCTGATATTCAAT
ATTTTAGTAATGATTTTGTTATTGATACTCAAAAACAAATAATTCGTTTT
GGTTTCAAAACAATTAAGGGTTTTGGTGATGAATTACTTAAAAAAATCAA
ATCTGCTCTGCAAAAATCAACTTTAAGCGATTATATTTCATACATTGATG
CTTTAAAAAAAGGCAATGTTAGTTTAAAAAACATTGAAATTTTGATACGA
GTCGGCACTTTTGATAGTTTTGGAATTAATCGTTTATTTTTATTAAATAA
TTTGAATGAAATTTTTGAAAAAACAGGATTGAATGGTCATTTTTTTGATT
TAAATTTAGTGGGTTTAGATTATGCAAAAGATATGAGTGTTAATGATCGT
TATTTAGATGATGAAATTCAGTATTTAGGAATTGATTTGAATAGTTTAAA
TTACGCAAATTATAAAACTGAAATTGATTATAATAAACTAAAATATACAA
TTAAAGACTTTTATGAAATAAACACAAATTATGAAACAAACATTCTTGCA
CAAGTTTTAAACATTAAGCAATCAAAAACTAAAAACGGGAATGATATCTT
TTATTTAGAAACACTAATTGATAATAAAAAACAAACACTAACAATTTTTC
AAAATAGTAAATATTTAATTGATGAAATTAGTATTGGAGGTATTTATGTT
TTTGGAGTTAAATTATTAAATCATTTTAATTTTATTGTAAATATTAAGCA
AAGGATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy