Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-2 IGR349 IGR345 IGR351 IGR346 IGR348 IGR350 IGR347 UU416 fpg, - UU413 PolI,polA,Dp01, - UU414 UU417 thiI, - UU418 dnaE, - UU415 gcp, - UU411 metK, - UU412 syi,ileS, - UU410 UU416 fpg, - UU413 PolI,polA,Dp01, - UU414 UU417 thiI, - UU418 dnaE, - UU415 gcp, - UU411 metK, - UU412 syi,ileS, - UU410 Type: tandem, Name:  - 259 Type: tandem, Name:  - 256 Type: tandem, Name:  - 257 Type: tandem, Name:  - 258 UU416 fpg, - UU413 PolI,polA,Dp01, - UU414 UU417 thiI, - UU418 dnaE, - UU415 gcp, - UU411 metK, - UU412 syi,ileS, - UU410
* Calculated from Protein Sequence

Gene ID: UU414

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
PolI  polA  Dp01  

Definition:
DNA polymerase I: 5'-3' exonuclease domain

Gene Start:
477987

Gene Stop:
477118

Gene Length:
870

Molecular Weight*:
32931

pI*:
9.90

Net Charge*:
6.49

EC:
2.7.7.7  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Comment:
In addition to polymerase activity, PolA exhibits 3' to 5' and 5' to 3' exonuclease activity. It is able to utilize nicked circular duplex DNA as a template and can unwind the parental DNA strand from its template.

Reaction:
N DEOXYNUCLEOSIDE TRIPHOSPHATE = N PYROPHOSPHATE + DNA(N).

See UU377, a predicted polC sequence.

Blast Summary:  PSI-Blast Search
Numerous significant hits to DNA polymerase I sequences; e.g. residues 3-284 are 38% similar to (X98575) DNA-dependent DNA polymerase of Anaerocellum thermophilum; residues 3-286 are 34% similar to (U78771) DNA polymerase I (PolI) of Lactococcus lactis; and residues 2-285 are 32% similar to DP01_STRPN.
BLAST also reveals significant similarity to MG262, a 5'-3' exonuclease (including N-terminal domain of PolI), TP0105 and CT493, both of which are DNA polymerase I sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0258 is Ehgpc--U.
Cog name: 5'-3' exonuclease (including N-terminal domain of PolI).
Functional class: L.
BeTs to -hg-c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-145 are 45% similar, and residues 156-221 are 59% similar to a defined domain of EX53_MYCGE, a DNA polymerase I sequence.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 2 to 172 (E-value = 2.3e-45) place UU414 in the 5_3_exonuc_N family which is described as 5'-3' exonuclease, N-terminal resolvase-like domain (PF02739)
Residues 175 to 274 (E-value = 2.2e-43) place UU414 in the 5_3_exonuc family which is described as 5'-3' exonuclease, C-terminal SAM fold (PF01367)

PDB Hit:
gi|3891938|pdb|1BGX|T Chain T, Taq Polymerase In Complex With Tp7, An Inhibitory Fab

Gene Protein Sequence:
MKKAIVIDGNSLIYRAFHATYKQAEWAVEKQLMPTNAIKLVASMIFKILN
QEQFTYGLIAMDASKQTFRAQEYAAYKATRKPMDAKLIVQLPYLKKLFVA
MGFRIISQPGIEADDFVGSFSNLMNKFDVDTTIYSSDRDMLQLINKNTKL
KLLKTGTSVMQEINLTNFSLLNNGILPYQIIEYKGLVGDSSDNLIGVKGI
GPKTAINLLLKYDNIENIYTNLEKIAPSVKNKLIEHKDMAFLSKKLAAIQ
TDLLFDEKLENFVLKPYNTQELDELFTSLKINNMQNYYK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAAGCAATTGTTATTGATGGAAATTCATTGATTTATCGAGCCTT
TCACGCTACTTATAAACAAGCTGAATGAGCAGTTGAAAAACAATTAATGC
CTACTAATGCCATTAAATTAGTAGCCTCAATGATTTTTAAGATTTTAAAT
CAAGAACAATTTACTTATGGTTTAATTGCTATGGACGCTTCTAAACAAAC
TTTTCGTGCTCAAGAATATGCTGCTTACAAAGCGACACGTAAACCTATGG
ATGCAAAACTAATTGTTCAATTACCCTATTTAAAAAAACTATTCGTTGCT
ATGGGTTTTCGAATAATTTCACAACCTGGAATTGAAGCTGACGATTTTGT
TGGTTCTTTTAGTAATTTAATGAATAAGTTTGATGTTGATACAACTATTT
ATAGTTCAGATCGTGATATGTTGCAATTAATTAACAAAAACACAAAACTT
AAACTCTTAAAAACAGGGACAAGTGTTATGCAAGAAATTAATTTAACAAA
TTTTTCATTATTAAATAATGGCATTTTACCGTATCAAATTATTGAATATA
AGGGTTTAGTGGGTGATAGTAGTGATAATTTAATTGGCGTGAAGGGAATC
GGCCCTAAAACAGCTATTAATTTACTTTTAAAATATGATAATATAGAAAA
TATTTATACTAATTTAGAAAAAATAGCACCTAGTGTTAAAAATAAATTAA
TTGAACACAAAGATATGGCTTTTTTATCAAAAAAATTAGCGGCGATTCAA
ACGGATTTATTGTTTGATGAAAAATTAGAAAATTTTGTTTTAAAACCATA
TAATACTCAAGAATTAGATGAGTTATTCACATCTTTAAAAATAAATAATA
TGCAAAATTATTATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy