Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-2 IGR349 IGR345 IGR346 IGR348 IGR350 IGR347 UU416 fpg, - UU413 PolI,polA,Dp01, - UU414 UU417 dnaE, - UU415 gcp, - UU411 metK, - UU412 syi,ileS, - UU410 UU416 fpg, - UU413 PolI,polA,Dp01, - UU414 UU417 dnaE, - UU415 gcp, - UU411 metK, - UU412 syi,ileS, - UU410 Type: tandem, Name:  - 256 Type: tandem, Name:  - 257 Type: tandem, Name:  - 258 fpg, - UU413 PolI,polA,Dp01, - UU414 UU417 dnaE, - UU415 UU416 gcp, - UU411 metK, - UU412 syi,ileS, - UU410
* Calculated from Protein Sequence

Gene ID: UU413

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fpg  

Definition:
formamidopyrimidine-DNA glycosylase

Gene Start:
477076

Gene Stop:
476249

Gene Length:
828

Molecular Weight*:
31979

pI*:
10.20

Net Charge*:
15.45

EC:
3.2.2.23  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
See Prosite PDOC00956.

From Prosite:

Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase)(gene fpg) is a bacterial enzyme involved in DNA repair and which excise oxidized purine bases to release 2,6-diamino-4-hydroxy-5N-methylformamido-pyrimidine (Fapy) and 7,8-dihydro-8-oxoguanine (8-OxoG) residues. In addition to its glycosylase activity, FPG can also nick DNA at apurinic/apyrimidinic sites (AP sites). FPG is a monomeric protein of about 32 Kd which binds and require zinc for its activity.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to formamidopyrimidine-DNA glycosylases; e.g. residues 1-274 are 48% similar to FPG_MYCPN; residues 1-274 are 40% similar to FPG_BACFI; and residues 1-274 are 39% similar to FPG_STRMU. Also significant similarity to: FPG_SYNY3, FPG_LACLC, FPG_HAEIN, FPG_ECOLI, and FPG_NEIME.
BLAST also reveals significant similarity to MG262.1, a formamidoprymidine-DNA glycosylase (mutM) sequence not in the original genbank record.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0266 is Ehgpc---.
Cog name: Formamidopyrimidine-DNA glycosylase.
Functional class: L.
BeTs to -h-pc---.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 1-274 span seven regions of similarity to blocks BL01242A-G (Formamidopyrimidine-DNA glycosylase proteins.)

ProDom Summary:  Protein Domain Search
Residues 132-274 are 53% similar to a defined domain of FPG_MYCPN.
Residues 1-126 are 49% similar to a defined domain of FPG_MYCPN.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 1 to 121 (E-value = 2e-41) place UU413 in the Fapy_DNA_glyco family which is described as Formamidopyrimidine-DNA glycosylase N-terminal domain (PF01149)
Residues 135 to 227 (E-value = 1.2e-38) place UU413 in the H2TH family which is described as Formamidopyrimidine-DNA glycosylase H2TH domain (PF06831)
Residues 247 to 275 (E-value = 1.1e-06) place UU413 in the zf-FPG_IleRS family which is described as Zinc finger found in FPG and IleRS (PF06827)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
81
transmembrane  
172  
195

PDB Hit:


Gene Protein Sequence:
MPELPEVQTIVDYLNHHVLDIFIKKTIVHLPKILKNKTPQEFEKLLINHK
IVKIKRLGKYLLFFLSNNLVLSVHLRMEGKFYYQAKEEWFNLAHTHIIIE
FNNGMQLRYNDTRQFGTFHIYEQQSFLDSKELKKIALDPLDNNFSAQYLY
EKLKKSNKAIKTALLDQSVVSGIGNIYADEILFAAKIFPTILAKNLTLKN
YEKITKEAQRILLLSIKNKGTTIHTYKFGNDETGLFQKMLLVHTHAKEPC
QICGTIIQKTKVNGRGTYYCPNCQN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAGAGCTACCAGAAGTACAAACGATTGTTGATTATTTAAATCATCA
TGTTCTCGATATTTTTATTAAAAAAACTATTGTTCATTTACCTAAAATTT
TAAAAAATAAAACACCACAAGAATTTGAAAAACTGTTAATTAATCATAAA
ATAGTCAAAATTAAACGTCTTGGTAAATATTTATTATTTTTTTTAAGTAA
TAATTTAGTATTAAGTGTACATTTGCGGATGGAGGGAAAATTTTATTATC
AAGCAAAAGAGGAATGATTTAATTTAGCACATACTCATATTATTATTGAA
TTTAATAATGGTATGCAATTAAGATATAATGATACGCGTCAATTTGGAAC
TTTTCACATTTATGAGCAACAATCTTTTTTAGATTCAAAAGAATTAAAAA
AGATTGCTTTAGATCCGCTAGATAATAATTTTTCAGCGCAGTATTTGTAT
GAAAAATTAAAAAAAAGTAATAAAGCCATTAAAACAGCCTTGTTAGATCA
ATCTGTTGTTTCAGGAATTGGTAACATTTATGCTGATGAAATTTTATTTG
CAGCTAAAATTTTTCCTACAATATTAGCTAAAAATCTTACTTTAAAAAAT
TATGAAAAGATCACAAAAGAAGCACAACGAATCTTATTATTATCAATTAA
AAATAAAGGAACAACAATCCACACTTATAAATTTGGTAATGATGAAACAG
GTTTGTTTCAAAAGATGTTATTAGTTCACACACACGCTAAAGAACCATGC
CAAATTTGTGGAACAATTATTCAAAAAACAAAGGTCAACGGTCGGGGAAC
TTATTATTGTCCAAATTGTCAAAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy