Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-2 IGR349 IGR345 IGR346 IGR348 IGR343 IGR344 IGR347 fpg, - UU413 PolI,polA,Dp01, - UU414 UU409 DnaJ, - UU407 dnaE, - UU415 gcp, - UU411 metK, - UU412 syi,ileS, - UU410 fpg, - UU413 PolI,polA,Dp01, - UU414 UU409 DnaJ, - UU407 dnaE, - UU415 gcp, - UU411 metK, - UU412 syi,ileS, - UU410 Type: tandem, Name:  - 255 Type: tandem, Name:  - 256 Type: tandem, Name:  - 257 fpg, - UU413 PolI,polA,Dp01, - UU414 UU409 dnaE, - UU415 UU408 DnaJ, - UU407 UU408 gcp, - UU411 metK, - UU412 syi,ileS, - UU410
* Calculated from Protein Sequence

Gene ID: UU411

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gcp  

Definition:
O-sialoglycoprotein endopeptidase

Gene Start:
473930

Gene Stop:
474892

Gene Length:
963

Molecular Weight*:
35434

pI*:
8.20

Net Charge*:
4.94

EC:
3.4.24.57  

Functional Class:
translation; degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:
See Prosite PDOC00779.

From Prosite: Glycoprotease (GCP), or o-syaloglycoprotein endopeptidase, is a metalloprotease secreted by Pasteurella haemolytica which specifically cleaves O-sialoglycoproteins such as glycophorin A.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to O-sialoglycoprotein endopeptidases; e.g. residues 1-310 are 41% similar to GCP_MYCPN; residues 7-318 are 33% similar to GCP_HAEIN; and residues 7-315 are 33% similar to GCP_PASHA.
BLAST also reveals significant similarity to MG046, CT197, and TP0680, all of which are O-sialoglycoprotein endopeptidases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0533 is EHgpCmYu.
Cog name: Metal-dependent protease.
Functional class: O.
BeTs to -h-pcmyu.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 7-303 span eight regions of similarity to blocks BL01016A-H (Glycoprotease family proteins.)

ProDom Summary:  Protein Domain Search
Residues 135-306 are 41% similar to a defined domain of GCP_MYCGE.
Residues 7-118 are 49% similar to a defined domain of GCP_MYCPN.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 6 to 279 (E-value = 7.2e-75) place UU411 in the Peptidase_M22 family which is described as Glycoprotease family (PF00814)

PDB Hit:


Gene Protein Sequence:
MNDNYLILSIESSCDETSLALFENNKLIAHKISSSASIQSLHGGVVPELA
SRYHEQNINHLFNEILNETKINPLTITHVAYTAMPGLPGCLHVGKVFAKQ
LAVLINAELVPINHLHAHVFSASINQNLTFPFLGLVVSGGESCIYLVNDY
DEIKVLNQTHDDAIGECYDKIARVLGWKYPGGPIIDKNYQENLATLEFIK
SQPAAKDFSFSGLKTAVINYIHNAKQKKISFDPVVVASSFQKFAINEIIK
KIKYYLNLYKLNHLAIGGGVSANSLLRKKIQSLDVISYIPEMIYTGDNAA
MIGAYAYALIKNHKKSILIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGATAATTATTTAATTTTAAGCATTGAATCAAGTTGTGATGAAAC
AAGTTTAGCGTTATTTGAAAATAATAAATTAATTGCTCATAAAATTAGTA
GTTCAGCATCTATACAATCACTTCATGGCGGTGTTGTTCCTGAATTAGCA
AGTCGTTATCATGAACAAAATATTAATCACCTATTTAATGAAATTTTAAA
TGAAACAAAAATCAACCCTTTAACTATCACTCACGTTGCTTACACTGCAA
TGCCTGGTTTGCCAGGTTGTTTACATGTAGGAAAAGTTTTTGCGAAACAA
TTAGCTGTTTTAATTAATGCTGAATTAGTGCCAATCAATCATTTACATGC
GCATGTTTTTAGTGCAAGTATTAATCAAAATTTGACTTTTCCATTTTTGG
GATTAGTGGTTTCAGGAGGGGAAAGTTGTATATATTTAGTAAATGATTAT
GATGAAATCAAAGTTTTAAATCAAACACACGATGATGCAATTGGTGAATG
TTATGATAAAATTGCTCGTGTTCTTGGTTGAAAATATCCAGGGGGTCCAA
TTATTGATAAAAATTATCAAGAAAATTTAGCAACATTAGAATTTATTAAA
TCACAGCCCGCTGCTAAAGATTTTAGTTTTAGTGGGTTAAAAACTGCTGT
AATTAATTACATTCATAATGCTAAACAAAAAAAGATAAGTTTTGACCCTG
TTGTTGTTGCTTCAAGTTTTCAAAAATTTGCAATTAATGAAATTATAAAG
AAAATTAAATATTACTTAAATTTATACAAATTAAATCATTTAGCAATTGG
GGGAGGCGTATCAGCTAATAGTTTACTCCGTAAAAAAATTCAATCTTTAG
ATGTTATATCATATATTCCAGAAATGATTTATACAGGTGATAATGCTGCT
ATGATTGGGGCTTATGCTTATGCTTTAATTAAAAATCATAAGAAATCAAT
ATTAATAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy