Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-2 IGR345 IGR346 IGR348 IGR342 IGR343 IGR344 IGR347 grpE, - UU406 fpg, - UU413 PolI,polA,Dp01, - UU414 UU409 DnaJ, - UU407 gcp, - UU411 metK, - UU412 UU405.1 syi,ileS, - UU410 grpE, - UU406 fpg, - UU413 PolI,polA,Dp01, - UU414 UU409 DnaJ, - UU407 gcp, - UU411 metK, - UU412 UU405.1 syi,ileS, - UU410 Type: tandem, Name:  - 255 Type: tandem, Name:  - 256 Type: tandem, Name:  - 257 grpE, - UU406 fpg, - UU413 PolI,polA,Dp01, - UU414 UU409 DnaJ, - UU407 UU408 UU408 gcp, - UU411 metK, - UU412 UU405.1 syi,ileS, - UU410
* Calculated from Protein Sequence

Gene ID: UU410

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
syi  ileS  

Definition:
isoleucyl-tRNA synthetase

Gene Start:
471224

Gene Stop:
473926

Gene Length:
2703

Molecular Weight*:
105803

pI*:
7.30

Net Charge*:
2.73

EC:
6.1.1.5  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Valine, leucine and isoleucine biosynthesis

Comment:
See Prosite PDOC00161.

From Prosite:

Aminoacyl-tRNA synthetases are a group of enzymes which activate amino acids and transfer them to specific tRNA molecules as the first step in protein biosynthesis. In prokaryotic organisms there are at least twenty different types of aminoacyl-tRNA synthetases, one for each different amino acid. In eukaryotes there are generally two aminoacyl-tRNA synthetases for each different amino acid: one cytosolic form and a mitochondrial form.

The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous highly significant hits in gapped BLAST to isoleucyl-tRNA synthetase sequences; e.g. residues 3-899 are 42% similar to SYI_MYCGE; residues 3-899 are 41% similar to SYI_STAAU; and residues 3-855 are 42% similar to SYI_BACSU. Also similar to: SYI_SYNY3, SYI_HAEIN, SYI_ECOLI, SYI_HELPY, and SYIM_YEAST.
BLAST also reveals significant similarity to MG345, CT019, and TP0452, all of which are isoleucyl-tRNA synthetases. Also significant similarity to MG334, CT302, and TP1035, all of which are valyl-tRNA synthtases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0060 is ehgpcmYu.
Cog name: Isoleucyl-tRNA synthetase.
Functional class: J.
BeTs to e-g-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 60-69 and 590-600 are in the 99.68th percentile of similarity to blocks BL00178A-B (Aminoacyl-transfer RNA synthetases class-I proteins.)

ProDom Summary:  Protein Domain Search
Residues 58-185 are 53% similar and residues 583-716 are 47% similar to a defined domain of SYI_BACSU.
Residues 476-582 are 45% similar to a defined domain of SYI_MYCPN.

Paralogs:  Local Blast Search
UU267, a valyl-tRNA synthetase sequence, is 25% similar and a probable paralog of UU410.
UU371, a leucyl-tRNA synthetase sequence, is 21% similar and a probable paralog of UU410.

Pfam Summary:  Pfam Search
Residues 27 to 632 (E-value = 6.6e-213) place UU410 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)
Residues 868 to 895 (E-value = 1.5e-06) place UU410 in the zf-FPG_IleRS family which is described as Zinc finger found in FPG and IleRS (PF06827)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
351  
378
non-globular  
765  
870

PDB Hit:
gi|6137708|pdb|1QU2|A Chain A, Insights Into Editing From An Ile-Trna Synthetase Structure With Trna(Ile) And Mupirocin

Gene Protein Sequence:
MKDYKSTLNMPTTGFEMRANLNVKEPKIQQFWVEHQIYEKLLTKNKDKKP
FILHDGPPYANGNIHIGHALNKILKDFVVSYHNMNNYYSPYIPGWDTHGL
PIEVALSKKIKLSNLSVNERREQCKKYALEQVNNQIQQFLRLGMISDFKQ
RYLTLDHNYEIDQLKLFTYMLKKGFIYQDFKPVFWSWSSQTALAESEIEY
ADRQSSAIYVKMKVVDHNDLFTDKPTSLVIWTTTPWTLPANLAIAIHPEL
VYSLIEYKNENYIIAKPLVETFVKKVGFEDYKWIKDFKANTLEKIKYISP
ISKKHAFVIMDEYVSANDGTGLVHNAPAFGLEDYYACKKYGIETVVMIDQ
FGKYNALVNDLELENMFYEDANQVILNRLMNEHLLIHHEVITHSVAHDWR
TKKPVMYRATKQWFVSIEKILPNILQTLNNDVKSTSFRGIERMHEMIVNR
KEWCISRQRVWGVPIPMIFDENHNAIMDHELVENIINVLNEKGVNAWFDL
DVNAFLTPKYLSMKNKTFYKEKDIMDVWFDSGSSYNILGHYNLNYPADVY
LEGYDQYRGWFNSSLITGTILNNRAPYKYLVAHGMVLDGEGYKMSKSKGN
VVDPLDVCKIYGADVLRLWIANSDYQNDTRISEEILKQNAEIYRRIRNTL
FKYSLSILNDFEPSVDFSFNVRQEEQFVLNEFNELHIKVIKAYENFDYQT
VVKLFNKFILDLSSWYFENIKDDMYCLAINDPIRKQIQSAVYWILKNSLI
DLTPIIPHTTEEAYSFLKDANKKESIRLEDFYDQSQFQFKKGIAHVKAFF
SIKDQIFNELENARKNNILKKNNEAFVTIAKNLILDDYLINNPKLLAKWF
GVAKIEFANNTNVANANFKKCLRCWNHFPDEEMYNDELSMNCYKVINKIK
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGATTATAAAAGCACCCTTAATATGCCTACTACAGGTTTTGAAAT
GCGTGCTAATTTAAACGTTAAAGAACCAAAAATTCAACAATTTTGAGTTG
AACACCAAATTTATGAAAAATTGCTAACTAAAAATAAAGACAAGAAGCCT
TTTATCTTGCATGATGGGCCGCCATATGCAAATGGAAATATTCATATTGG
TCACGCTTTAAATAAAATACTAAAAGATTTTGTTGTTTCATATCACAATA
TGAATAATTATTACTCTCCTTATATTCCAGGATGAGATACACATGGTTTA
CCAATTGAGGTTGCCTTATCTAAAAAAATTAAATTATCTAATCTAAGTGT
TAATGAACGTCGTGAACAATGTAAAAAATACGCTTTAGAACAAGTTAATA
ATCAAATACAACAATTTTTAAGATTAGGAATGATATCAGATTTTAAACAA
CGCTATTTGACATTAGACCATAATTACGAAATAGATCAATTAAAACTTTT
TACTTATATGCTAAAAAAAGGTTTTATTTATCAAGACTTTAAGCCTGTTT
TTTGGTCATGATCATCACAAACAGCATTAGCAGAATCAGAGATCGAGTAT
GCTGATCGTCAATCTTCAGCTATTTACGTAAAAATGAAGGTAGTTGATCA
TAATGATTTGTTTACTGATAAACCAACATCATTAGTGATTTGAACAACAA
CTCCATGAACATTACCAGCTAATTTAGCAATTGCAATTCATCCAGAATTA
GTTTACAGTTTAATTGAATATAAAAATGAAAATTATATAATCGCTAAACC
TCTTGTTGAAACTTTTGTAAAAAAAGTTGGGTTTGAAGATTATAAATGAA
TTAAAGATTTTAAAGCTAATACTTTAGAAAAAATAAAATATATTTCACCA
ATTAGTAAAAAGCATGCTTTTGTGATCATGGATGAGTATGTTAGTGCTAA
TGACGGAACGGGTTTAGTTCATAATGCGCCTGCTTTTGGTTTAGAAGACT
ATTATGCATGTAAAAAATATGGTATTGAAACAGTAGTTATGATAGACCAA
TTTGGTAAATACAATGCATTAGTAAATGATTTAGAATTAGAAAATATGTT
TTATGAAGATGCTAATCAAGTTATTTTAAATCGTTTGATGAATGAACATT
TATTAATCCATCATGAAGTTATCACTCATAGTGTTGCACATGATTGAAGA
ACAAAAAAACCTGTTATGTATCGTGCCACAAAACAATGGTTTGTTTCTAT
TGAAAAAATTTTACCTAACATTTTGCAGACCCTAAATAACGATGTTAAAT
CAACTAGTTTTAGAGGAATTGAAAGAATGCATGAAATGATTGTTAATCGT
AAGGAATGATGTATATCACGTCAACGCGTTTGAGGTGTTCCTATTCCTAT
GATTTTTGATGAGAATCATAATGCAATTATGGATCATGAATTAGTAGAAA
ATATCATTAATGTTTTAAATGAAAAAGGTGTTAATGCATGATTTGATTTA
GATGTAAATGCTTTTTTAACACCTAAGTATTTAAGTATGAAAAATAAAAC
TTTTTATAAAGAAAAAGACATTATGGATGTTTGATTTGATTCTGGTAGTT
CATATAATATTTTAGGACACTATAACCTAAATTATCCAGCAGACGTTTAT
TTAGAAGGTTATGATCAATATCGTGGTTGATTTAATTCTTCATTAATTAC
AGGGACAATTTTAAACAATCGCGCACCTTATAAATATTTAGTAGCACATG
GAATGGTTCTAGATGGTGAAGGATATAAGATGTCAAAATCAAAAGGAAAT
GTTGTTGATCCATTAGATGTATGTAAGATTTATGGAGCAGATGTTTTAAG
ATTATGAATTGCTAATTCAGATTATCAGAATGATACAAGAATTTCAGAAG
AGATATTAAAACAAAATGCTGAAATTTACCGAAGAATTAGAAATACTTTA
TTTAAATATTCATTATCAATCTTAAATGATTTTGAACCAAGTGTTGATTT
TAGTTTTAATGTTCGTCAAGAAGAGCAATTTGTTTTAAATGAATTTAATG
AGTTACATATAAAAGTTATTAAAGCATATGAGAATTTTGATTATCAAACC
GTTGTTAAACTATTTAACAAATTTATCTTAGATTTATCATCATGATATTT
TGAAAATATTAAAGATGATATGTACTGTTTGGCAATTAATGATCCAATTC
GCAAACAAATTCAATCAGCAGTTTATTGAATTTTAAAAAATTCATTAATT
GATTTAACACCAATTATTCCACACACAACTGAAGAAGCTTACTCGTTTTT
AAAAGATGCTAATAAAAAAGAATCAATCCGTTTAGAGGATTTTTATGATC
AATCCCAATTTCAATTCAAAAAAGGCATTGCTCATGTTAAAGCATTCTTT
AGTATTAAAGATCAAATTTTTAATGAACTTGAAAATGCACGAAAAAATAA
TATTTTAAAGAAAAATAATGAAGCTTTTGTAACAATTGCAAAAAATTTGA
TTTTAGATGATTATTTGATAAATAATCCAAAACTATTAGCAAAATGGTTT
GGTGTTGCTAAGATTGAATTTGCTAATAACACAAATGTGGCTAATGCTAA
TTTTAAAAAGTGCTTACGTTGTTGAAATCATTTCCCTGATGAAGAAATGT
ACAATGATGAATTATCAATGAATTGTTATAAAGTAATTAATAAAATAAAA
TAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy