Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR345 IGR340 IGR342 IGR343 IGR344 IGR341 IGR339 grpE, - UU406 UU405 tnp, - UU404 UU409 DnaJ, - UU407 UU403 gcp, - UU411 UU405.1 syi,ileS, - UU410 grpE, - UU406 UU405 tnp, - UU404 UU409 DnaJ, - UU407 UU403 gcp, - UU411 UU405.1 syi,ileS, - UU410 Type: tandem, Name:  - 254 Type: tandem, Name:  - 255 Type: tandem, Name:  - 384 grpE, - UU406 UU405 tnp, - UU404 UU409 DnaJ, - UU407 UU408 UU408 UU403 gcp, - UU411 UU405.1 syi,ileS, - UU410
* Calculated from Protein Sequence

Gene ID: UU407

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
DnaJ  

Definition:
heat shock protein

Gene Start:
469594

Gene Stop:
468467

Gene Length:
1128

Molecular Weight*:
41828

pI*:
8.10

Net Charge*:
5.29

EC:
 

Functional Class:
cellular processes; chaperones  

Pathway: pathway table

Comment:
DnaJ interacts with DnaK, to disassemble a protein complex at the phage lambda origin of replication. It stimulates, jointly with GrpE, the ATPase activity of DnaK. It is induced by heat shock under the control of HtpR. An NMR structure is available. See UU339 for the DnaK gene in U.u., and UU406 for the GrpE gene in U.u.

The complete list of dna() genes in U.u. are: UU001, a predicted dnaA sequence; UU019, a predicted dnaH sequence; UU079, a predicted dnaN sequence; UU087, a predicted dnaX sequence; UU339, a predicted dnaK sequence; UU407, a predicted dnaJ sequence; UU415, a predicted dnaE sequence; UU494, a predicted dnaG sequence; and UU550, a predicted dnaB sequence.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to heat shock DnaJ protein sequences; e.g. residues 3-372 are 36% similar to DNAJ_MYCGE; residues 1-355 are 37% similar to DNAJ_BACSU; and residues 1-362 are 35% similar to DNAJ_STAAU. Also similar to: DNAJ_ERYRH, DNAJ_COXBU, DNAJ_HAEIN, DNAJ_LACLA, DNAJ_CLOAB, DNAJ_SALTY, and DNAJ_ECOLI.
BLAST also reveals significant hits to MG019, CT341, TP0217, TP0217A, MG200, TP0098, MG002, and TP0843, all of which are heat-shock proteins.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0485 is EhgpCmYu.
Cog name: DnaJ-type Zn finger domain.
Functional class: R.
BeTs to -h-pcmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 20-36 and 45-65 are in the 99.97th percentile of similarity to blocks BL00636A,B (Nt-dnaJ domain proteins.)

ProDom Summary:  Protein Domain Search
Residues 1-66 are 73% similar to a defined domain of DNAJ_BACST.
Residues 194-310 are 39% similar to a defined domain of DNAJ_BACSU.
Residues 120-191 are 43% similar to a defined domain of DNAJ_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 5 to 68 (E-value = 6.3e-38) place UU407 in the DnaJ family which is described as DnaJ domain (PF00226)
Residues 135 to 219 (E-value = 5.7e-25) place UU407 in the DnaJ_CXXCXGXG family which is described as DnaJ central domain (4 repeats) (PF00684)
Residues 232 to 355 (E-value = 5.2e-15) place UU407 in the DnaJ_C family which is described as DnaJ C terminal region (PF01556)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
65  
114
non-globular  
254  
375

PDB Hit:
gi|5542126|pdb|1BQ0| J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures

Gene Protein Sequence:
MAKRDYYEILGVSKSATPEEIKAAFRKLAKEHHPDRNKSADDTLFKEINE
AYEVLSDSKKRAQYDQFGHDGPQGFSSASGFSGFSGGFGGVDFDINDIFG
SFFNNASSSHNSSNQYETYDIHLRLHLDFMEAVNGISKNINYDRKITCHK
CQGTGAKDPKDVKICTKCHGRGTSIENVHSLFGTIQQEVECHECEGTGKV
ASSKCEQCYGKKVINERVNLTVEIPAGTREGEKLLVSKKGNIVNNQEFDL
YLHISVKPSKYFALDGLDIYSETYIDPIKAIVGGIIEVVTINGIKTIEIP
SNTPEGKKFRISGSGIVNKKSNIFGKKNGDFYTTIRYAKPVELSKDEIAY
LKNISTRTNQNVEYYKNKVLKEISK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAAACGTGATTATTATGAAATTTTAGGTGTTAGTAAATCAGCAAC
TCCTGAAGAGATTAAAGCGGCATTTCGTAAATTAGCAAAAGAACACCATC
CTGATCGTAATAAATCTGCTGATGATACTCTTTTTAAAGAAATTAATGAA
GCATATGAGGTTTTATCTGATTCTAAAAAACGTGCACAATACGACCAATT
TGGCCATGATGGTCCACAAGGTTTTAGCAGTGCTAGTGGGTTTTCTGGGT
TTAGTGGAGGATTTGGTGGTGTTGATTTTGATATTAATGACATTTTTGGC
AGTTTTTTTAATAATGCTTCTAGTTCACATAATTCATCAAACCAATATGA
AACATATGATATTCACTTACGTTTACATTTAGATTTTATGGAAGCTGTTA
ATGGTATTTCTAAAAATATTAATTATGATCGTAAAATTACGTGTCATAAA
TGTCAAGGAACAGGTGCAAAAGATCCTAAAGATGTCAAAATTTGCACTAA
ATGTCACGGTAGAGGAACTAGCATTGAAAATGTTCATTCCTTATTTGGAA
CAATTCAACAAGAAGTTGAATGTCATGAGTGTGAAGGAACAGGTAAAGTT
GCTAGTAGCAAATGTGAACAATGTTATGGTAAAAAAGTTATCAATGAACG
TGTTAATTTAACTGTTGAAATCCCAGCAGGTACACGAGAAGGTGAAAAAT
TATTAGTAAGCAAAAAAGGTAATATTGTCAATAATCAAGAATTTGATCTT
TATTTACACATTAGTGTTAAACCATCAAAGTATTTTGCATTAGATGGTTT
AGATATTTATTCAGAAACTTACATTGATCCCATCAAAGCAATTGTTGGAG
GAATAATTGAAGTAGTAACAATTAATGGTATTAAAACCATTGAAATTCCT
TCAAATACTCCTGAAGGTAAAAAATTTAGAATTAGTGGATCAGGAATCGT
TAATAAAAAATCAAATATTTTTGGTAAAAAGAATGGAGATTTTTATACTA
CAATTCGTTATGCAAAGCCAGTTGAATTATCCAAAGATGAAATTGCTTAT
TTAAAAAATATTTCTACTCGTACAAACCAAAATGTTGAGTATTATAAAAA
TAAAGTATTAAAGGAGATTAGTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy