Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR335 IGR336 IGR337 IGR340 IGR334 IGR342 IGR333 IGR338 IGR341 IGR339 grpE, - UU406 UU405 tnp, - UU404 rnhB, - UU397 fatD, - UU400 hmuU, - UU399 trmU, - UU402 UU401 UU398 UU403 UU405.1 grpE, - UU406 UU405 tnp, - UU404 rnhB, - UU397 fatD, - UU400 hmuU, - UU399 trmU, - UU402 UU401 UU398 UU403 UU405.1 Type: tandem, Name:  - 384 Type: tandem, Name:  - 252 Type: tandem, Name:  - 253 Type: tandem, Name:  - 254 grpE, - UU406 UU405 tnp, - UU404 rnhB, - UU397 fatD, - UU400 hmuU, - UU399 trmU, - UU402 UU401 UU398 UU403 UU405.1
* Calculated from Protein Sequence

Gene ID: UU402

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trmU  

Definition:
probable tRNA-(5-methylaminomethyl-2-thiouridylate) methyltransferase, TRMU.

Gene Start:
463432

Gene Stop:
462275

Gene Length:
1158

Molecular Weight*:
44265

pI*:
8.70

Net Charge*:
7.37

EC:
2.1.1.61  

Functional Class:
translation; tRNA modification  

Pathway: pathway table

Comment:
In E.coli this enzyme adds SAM to tRNA to yield a modified tRNA. Consider also PP-loop ATPase function.

See UU567, a predicted trmD sequence.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to predicted tRNA-(5-methylaminomethyl-2-thiouridylate) methyltransferases; e.g. residues 27-368 are 43% similar to TRMU_BACSU; residues 27-370 are 42% similar to TRMU_HAEIN; and residues 27-370 are 42% similar to TRMU_ECOLI. Also similar to: TRMU_MYCPN, TRMU_SCHPO, and TRMU_YEAST.
BLAST also reveals significant similarity to CT287 and MG295, both of which are probable tRNA-(5-methylaminomethyl-2-thiouridylate) methyltransferase, TRMU. No significant similarity to T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0482 is ehgpc-yU.
Cog name: Predicted ATPase of the PP-family.
Functional class: R.
BeTs to -h-pc-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 8-27 and 278-330 are in the 99.88th percentile of similarity to blocks BL01263B,E (Uncharacterized protein family UPF0021 proteins.)


ProDom Summary:  Protein Domain Search
Residues 109-368 are 47% similar to a defined domain of TRMU_BACSU, a methyltransferase.
Residues 7-108 are 54% similar to a defined domain of TRMU_ECOLI.
Residues 9-108 are 35% similar to a defined domain of TRMU_YEAST.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 7 to 368 (E-value = 3.6e-172) place UU402 in the tRNA_Me_trans family which is described as tRNA methyl transferase (PF03054)

PDB Hit:


Gene Protein Sequence:
MEVKVKKRVVVGLSGGVDSSVSALLLKQEGYEVIGLFMSNWDTIANFENN
HEFNKTHQGCESELDYQDAQAVAQKIGIPLYRVEFIKEYWDNVFEYFLSE
YQKNRTPNPDILCNQFIKFDSFLNYAKNELQADYIAMGHYARVKHDRNSS
FLLKAIDTNKDQTYFLCNLNQNQLQNVLFPIGHLTKLQVRAIAKKHGLIT
ANKKDSTGICFIGERNFKTFLQNYIPNQPGQIINIVNNQIIGHHIGTMYY
TIGQRKGLNLGGMNERMFVCDKDIDKKIIYVAPSSFEKQYLISTQALIEN
INFIEPYNPQIPIMVRFRHRQDLIIVNDFLPIKNTKNVLINYESARAITP
GQYAVFYQNDHCIGGGIVSKTNIGHQKVDFLVYKS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGTTAAAGTAAAAAAACGTGTCGTTGTTGGCTTGTCTGGTGGCGT
AGATTCTTCTGTTAGTGCTTTATTATTAAAACAAGAAGGCTATGAAGTGA
TTGGTTTATTTATGAGTAATTGGGATACAATTGCAAATTTTGAAAATAAC
CATGAATTTAATAAAACGCATCAGGGTTGTGAGAGTGAATTAGATTACCA
AGATGCTCAGGCTGTTGCTCAAAAGATCGGTATTCCATTATATCGTGTTG
AATTTATTAAAGAATATTGAGATAACGTTTTTGAATATTTTTTAAGCGAA
TATCAAAAGAACCGTACACCTAATCCTGATATTTTATGTAATCAATTTAT
TAAATTTGATTCTTTTTTAAATTATGCTAAAAATGAATTACAAGCTGACT
ATATTGCAATGGGTCATTATGCAAGAGTTAAGCATGATAGGAATTCATCT
TTTTTACTAAAAGCTATTGATACAAATAAGGATCAAACTTATTTTTTGTG
TAATTTAAACCAAAATCAACTACAGAATGTGCTATTTCCTATTGGGCATT
TAACTAAACTACAGGTGCGCGCTATTGCTAAAAAACACGGTTTGATTACA
GCTAATAAGAAAGATTCAACAGGGATTTGTTTTATTGGTGAACGTAATTT
TAAAACTTTTTTACAAAATTATATTCCTAACCAACCAGGGCAAATTATAA
ATATTGTCAATAATCAAATTATTGGTCATCACATAGGAACAATGTATTAT
ACAATTGGACAACGAAAAGGATTGAATCTAGGTGGCATGAATGAGAGAAT
GTTTGTTTGTGATAAAGATATCGATAAAAAAATAATCTACGTTGCCCCTT
CAAGTTTTGAAAAACAATATTTAATTTCAACTCAAGCATTAATTGAAAAT
ATAAATTTTATTGAACCATATAATCCTCAAATTCCAATTATGGTACGCTT
TCGTCACCGACAAGATTTAATAATAGTAAACGATTTTTTACCTATTAAAA
ATACCAAAAATGTACTAATAAATTATGAGTCAGCTAGAGCTATTACTCCT
GGGCAATATGCTGTCTTTTACCAAAATGATCATTGCATTGGCGGTGGAAT
TGTTTCTAAAACTAATATTGGACATCAAAAAGTGGATTTTTTGGTATATA
AATCATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy