Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR331 IGR335 IGR329 IGR336 IGR337 IGR328 IGR332 IGR330 IGR334 IGR333 IGR327 UU396 UU395 UU394 UU393 rnhB, - UU397 fatD, - UU400 hmuU, - UU399 trmU, - UU402 UU401 UU398 UU392 clpB, - UU391 UU396 UU395 UU394 UU393 rnhB, - UU397 fatD, - UU400 hmuU, - UU399 trmU, - UU402 UU401 UU398 UU392 clpB, - UU391 Type: tandem, Name:  - 251 Type: tandem, Name:  - 248 Type: tandem, Name:  - 253 Type: tandem, Name:  - 249 Type: tandem, Name:  - 252 Type: tandem, Name:  - 450 Type: tandem, Name:  - 250 UU395 UU393 rnhB, - UU397 fatD, - UU400 hmuU, - UU399 trmU, - UU402 UU401 UU396 UU394 UU398 UU392 clpB, - UU391
* Calculated from Protein Sequence

Gene ID: UU397

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rnhB  

Definition:
ribonuclease HII

Gene Start:
457869

Gene Stop:
456919

Gene Length:
951

Molecular Weight*:
36405

pI*:
10.10

Net Charge*:
13.07

EC:
3.1.26.4  

Functional Class:
transcription; RNA degradation  

Pathway: pathway table

Comment:
Similar to RNAse H of retroviruses -- degrades ribonucleotide portion of RNA-DNA hybrid.

See Bellgard and Gojobori, FEBS Letters 445:6-8, 1999.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ribonuclease HII sequences; e.g. residues 103-311 are 33% similar to RNH2_STRPN; residues 92-313 are 27% similar to (AE001275) Ribonuclease HII of Chlamydia trachomatis; and residues 103-304 are 23% similar to (AB012613) ribonuclease HII of Pyrococcus kodakaraensis.
BLAST also reveals significant similarity to CT008, a ribonuclease HII; and to MG199, a conserved hypothetical protein (M. genitalium predicted coding region MG199)/ possible ribonuclease HII.
Weak similarity to CT029, a ribonuclease HII. No significant similarity to T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0164 is eh--cmy-.
Cog name: Ribonuclease HII.
Functional class: L.
BeTs to ----cmy-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 105-118, 137-156, and 239-259 are in the 98.32th percentile of similarity to blocks PF01351A-C (Ribonuclease HII.)

ProDom Summary:  Protein Domain Search
Residues 189-311 are 33% similar to a defined domain of RNH2_STRPN, a ribonuclease HII.
Residues 85-175 are 29% similar to a defined domain of O67644_AQUAE, a ribonuclease HII.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 104 to 309 (E-value = 3.1e-10) place UU397 in the RNase_HII family which is described as Ribonuclease HII (PF01351)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
75  
210
transmembrane  
242  
266

PDB Hit:


Gene Protein Sequence:
MAIVSVKLTSNQVDKFLILWRPYLVHNNHNYAKYTFKIDGTLIIIYNTNT
CTINTHDINSFLNTFLKREDLTLFNVIKQQVNTKKNNQNVMSQSEIYESA
QVIIGSDEVGVGDLFGGIVVCAVSLKKSDFKKINHLKIIDSKKLNDQQMQ
EIYQQIKNQISYTIVSYNPKEYNELIKEYNNAHILKTILHYKALQSEIHK
HAKYSIFSVVDAFSSLKNWNQYLQKVNFQPYEPNLLIPKAESIYTSVALA
SIIARVMFLKMIAIIEEQFNVKIPLGSSNPLVNDVASNIFQKFGLKILKQ
VAKEHFSNFQQIIKNK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAATTGTTTCTGTTAAATTAACATCTAATCAAGTTGATAAATTCTT
AATTCTATGAAGACCATATTTAGTACATAACAACCATAATTATGCTAAAT
ATACTTTTAAGATCGATGGTACTTTAATCATTATTTACAATACTAACACA
TGTACTATTAATACTCATGATATAAATTCTTTTTTAAACACATTTTTAAA
AAGAGAAGATTTAACACTATTTAATGTTATAAAACAACAAGTAAACACTA
AAAAAAATAATCAAAATGTTATGAGCCAATCAGAAATTTATGAAAGTGCC
CAAGTAATTATTGGGTCTGATGAGGTTGGAGTTGGCGATTTATTTGGAGG
TATAGTTGTTTGCGCAGTGAGTTTAAAAAAAAGTGATTTTAAAAAAATAA
ATCATTTAAAAATCATAGATTCTAAAAAACTCAATGATCAGCAAATGCAA
GAAATATATCAACAAATTAAAAATCAGATTTCATATACAATTGTTTCTTA
TAATCCTAAAGAATACAATGAATTAATTAAAGAATACAATAATGCACATA
TTCTTAAAACTATTTTACATTATAAAGCATTACAAAGTGAAATTCACAAA
CACGCTAAATATTCAATTTTTAGTGTTGTTGATGCTTTTAGTTCATTAAA
AAACTGAAATCAATATTTACAAAAAGTCAATTTTCAACCTTATGAACCAA
ACTTATTAATCCCTAAAGCCGAATCAATTTATACAAGTGTAGCTTTGGCG
TCAATAATTGCACGTGTTATGTTTTTAAAAATGATTGCAATTATTGAAGA
ACAATTTAACGTTAAAATCCCGTTAGGAAGTTCAAATCCTTTAGTTAATG
ACGTCGCTAGTAATATTTTTCAAAAATTTGGCTTAAAAATTTTAAAACAA
GTCGCTAAAGAACACTTTAGTAACTTTCAACAAATTATTAAAAATAAATA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy