Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR331 IGR329 IGR328 IGR332 IGR330 IGR325 IGR326 IGR327 UU396 UU395 UU394 UU393 rnhB, - UU397 UU390 UU392 clpB, - UU391 UU389 UU396 UU395 UU394 UU393 rnhB, - UU397 UU390 UU392 clpB, - UU391 UU389 Type: tandem, Name:  - 247 Type: tandem, Name:  - 248 Type: tandem, Name:  - 249 Type: tandem, Name:  - 450 Type: tandem, Name:  - 250 UU395 UU393 rnhB, - UU397 UU396 UU394 UU390 UU392 clpB, - UU391 UU389
* Calculated from Protein Sequence

Gene ID: UU391

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
clpB  

Definition:
ATP-dependent serine proteinase subunit B

Gene Start:
451524

Gene Stop:
453638

Gene Length:
2115

Molecular Weight*:
80551

pI*:
6.80

Net Charge*:
-1.24

EC:
3.4.21.-  

Functional Class:
cellular processes; chaperones  
translation; degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:
CLPA, CLPB, CLPC are chaperone proteins, not regarded to be true heat-shock proteins but which support degradation of denatured proteins under conditions of high temperature. They have ATPase activity and provide subunit support to an ATP-dependent protein, the ClpP.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to CLPB proteins, e.g. residues 8-692 are 57% similar to CLPB_MYCGE (MG355). UU391 is also similar to TP0071, CT113, CT286, TP0549 and TP0801, various ATP-dependent protease subunits.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0542 is EhgpC-YU.
Cog name: ATPases with chaperone activity, ATP-dependent protease subunit.
Functional class: O.
BeTs to -hg-c-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 26-665 span eleven regions of similarity to blocks BL00870A-I, which encompass clpA/B chaperonins, e.g. CLPB_MYCGE, CLPB_HELPY.





ProDom Summary:  Protein Domain Search
Residues 8-252, 267-390, 491-576 and 584-692 are 73%, 37%, 72% 38% similar to CLPB domains of CLPB_MYCGE.
Residues 424-490 are 71% similar to a LON/FTSH domain of O68185_XXXXX.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 52 to 247 (E-value = 2e-09) place UU391 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 454 to 668 (E-value = 1.2e-05) place UU391 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
68
coil-coil  
246  
277
coil-coil  
290  
388
non-globular  
527  
648

PDB Hit:


Gene Protein Sequence:
MEFKQKNSNNPLEEFGRNLNKEILDNKIDPIIGRDEEIRRTIEILSRKTK
NNPVLIGEPGVGKTAIVEGLAYRIVHKDVPSNLLDKTIIELSLSSLIAGA
SYQGQFEERINSILKEVKKADGNIILFIDEIHQIVGMGRNQGSNMDVANI
LKPMMARGEIKLIGATTLDEYRLYIEKDQALERRFTKVLVNKPTIQETLT
IMRGLKPRWEAFHGIKIHDNALIAAVNLSERYINDRNLPDKAIDLIDEAA
AKIKTQINSQPIYLDEIKRDLQHLQTEKAALEPEKDEKSIKRLNEILEKI
KLKQDEFNNLNDLYLKEKKQIDDLKNLRQKIERIQHDIEFYQSEGKYEKA
SRLLYSDLPLFEKQREELENKINENNNQKMIIDSLTENEIADVIARATGI
PLSHLLADEKTKLLSLNKRIASHVIGQDEAVKLISDAVIRGRAGINNPNQ
PIGSFLFLGPTGVGKTELAKTLAKELFNSEKALIRFDMSEYMEKHSVSKL
VGAPPGYIGYENAGVLTESVKRKPYSILLFDEIEKAHPDILNILLQILDE
GSIKDAKNNEINFKNTIIIMTSNIGAEALLENNKTKALLDLQKTFKPEIL
NRISEIIFFNKLSKEIIFKISENLLKELENLLAKQDYLIKFDDNIAQIMV
EDAYSSNYGARPLKRWITKHLENEIAKLIIENRITKNINYKINYDRELDQ
VLIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAATTTAAACAAAAAAACTCAAACAATCCATTAGAGGAATTTGGACG
TAATTTAAATAAGGAAATTTTAGATAATAAAATTGACCCCATTATCGGTC
GAGATGAAGAAATTAGAAGAACCATTGAAATTCTAAGTCGTAAAACTAAG
AATAATCCTGTCTTAATTGGTGAACCTGGTGTTGGTAAAACAGCAATTGT
TGAGGGGCTTGCATACCGAATTGTTCATAAAGATGTTCCTTCAAACTTAT
TAGATAAAACAATTATTGAATTATCATTATCATCTTTAATTGCAGGCGCT
AGTTATCAAGGCCAGTTTGAGGAACGAATTAATAGTATTTTAAAAGAAGT
CAAAAAAGCAGATGGTAATATCATTTTGTTTATTGATGAAATACATCAAA
TTGTTGGTATGGGTAGAAATCAAGGTTCAAATATGGATGTTGCTAATATT
TTAAAACCAATGATGGCAAGAGGAGAAATCAAATTAATTGGCGCCACAAC
GCTTGATGAGTATCGTTTATATATTGAAAAAGATCAGGCATTAGAACGTC
GTTTTACAAAAGTTTTAGTTAACAAACCAACAATTCAAGAAACTTTAACA
ATAATGCGAGGTTTAAAGCCACGGTGAGAAGCCTTTCATGGGATTAAAAT
CCATGATAATGCATTAATTGCTGCTGTTAATTTATCTGAACGTTACATAA
ATGATCGTAATTTGCCAGATAAAGCTATTGATTTAATTGATGAAGCAGCT
GCAAAGATTAAAACGCAAATTAATTCACAACCAATATATTTAGATGAAAT
TAAACGTGATTTACAACATTTACAAACTGAAAAAGCCGCTTTAGAACCAG
AAAAAGATGAAAAATCAATTAAACGTTTAAATGAAATTTTAGAAAAAATT
AAATTAAAACAAGATGAATTTAACAATTTAAATGATTTGTATTTAAAAGA
AAAAAAGCAAATTGACGATTTAAAAAATTTACGGCAAAAAATTGAAAGAA
TTCAACATGATATTGAATTTTATCAATCTGAGGGTAAGTATGAAAAAGCA
TCAAGATTACTTTATTCAGATTTACCATTATTTGAAAAACAACGAGAAGA
ATTAGAAAATAAAATTAATGAGAATAATAATCAAAAAATGATTATTGATT
CATTAACAGAGAATGAAATTGCTGATGTTATTGCGCGTGCTACAGGAATT
CCATTAAGTCATTTATTAGCTGATGAAAAAACAAAATTATTATCGCTAAA
CAAACGAATTGCTAGTCATGTTATTGGTCAAGATGAAGCAGTTAAATTAA
TAAGTGATGCGGTAATCCGTGGTCGTGCAGGTATTAATAATCCTAACCAA
CCTATTGGTTCTTTCTTATTTTTAGGACCTACGGGCGTTGGTAAAACAGA
ATTAGCAAAAACTTTAGCAAAAGAATTGTTCAATTCAGAAAAAGCCTTAA
TTAGATTTGATATGAGTGAATATATGGAAAAACATAGTGTATCAAAATTA
GTTGGTGCTCCACCTGGTTATATTGGTTATGAAAATGCTGGAGTTTTAAC
TGAATCTGTTAAACGCAAACCATATAGTATTTTGTTATTTGATGAAATTG
AAAAAGCACACCCTGATATTTTAAATATTTTATTACAAATATTGGATGAA
GGTAGCATTAAGGATGCTAAAAATAATGAAATTAATTTTAAAAATACAAT
TATTATTATGACATCTAATATTGGAGCAGAAGCTTTATTAGAAAATAATA
AAACAAAGGCATTACTTGATTTACAAAAAACTTTTAAACCAGAAATTTTA
AACCGAATTTCTGAAATTATTTTCTTTAATAAGTTATCAAAAGAAATCAT
TTTTAAGATTAGTGAAAATTTACTTAAAGAATTAGAAAATTTATTAGCTA
AGCAAGATTATTTAATTAAATTTGATGATAATATTGCTCAAATCATGGTT
GAAGATGCTTATAGTTCAAATTATGGTGCAAGACCTTTAAAACGATGAAT
TACAAAACATTTAGAAAATGAAATTGCTAAATTAATAATTGAAAATCGTA
TTACAAAAAACATAAATTATAAAATAAATTATGATCGTGAACTAGATCAA
GTTTTAATTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy