Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR319 IGR322 IGR321 IGR317 IGR320 IGR318 UU380 UU379 gpsA,gpdA, - UU382 UU383 uvrC, - UU381 UU386 UU384 UU387 UU378 UU380 UU379 gpsA,gpdA, - UU382 UU383 uvrC, - UU381 UU386 UU384 UU387 UU378 Type: tandem, Name:  - 244 Type: tandem, Name:  - 241 Type: tandem, Name:  - 242 Type: tandem, Name:  - 243 UU379 gpsA,gpdA, - UU382 UU383 uvrC, - UU381 UU379.1 UU380 UU379.1 UU386 UU384 UU387 UU378 UU385 UU385
* Calculated from Protein Sequence

Gene ID: UU382

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gpsA  gpdA  

Definition:
NAD+ dependent glycerol-3-phosphate dehydrogenase

Gene Start:
440513

Gene Stop:
439539

Gene Length:
975

Molecular Weight*:
36383

pI*:
8.70

Net Charge*:
5.20

EC:
1.1.1.8  1.1.1.94  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to NAD+ dependent glycerol-3-phosphate dehydrogenases, e.g.
residues 1-311 are 26% similar to GPDA_BACSU. Other similarities are to GPDA_HAEIN and GPDA_ECOLI.
UU382 is weakly similar to CT714 and TP1009, predicted GPDA sequences. No similarity to M.genitalium.



COGS Summary:  COGS Search
The phylogenetic pattern of COG0240 is eh--c-Yu.
Cog name: Glycerol 3-phosphate dehydrogenase.
Functional class: C.
BeTs to -h--c-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 3-307 span five regions of similarity to blocks BL00957A,C-F,
concerned with GPDA sequences, e.g. GPDA_ECOLI. Residues 3-25 are
similar to block PR00420A concerned with aromatic-ring hydroxylases, e.g.
NAHG_PSEPSU.



ProDom Summary:  Protein Domain Search
Residues 162-319 are 31% similar to an NAD dehydrogenase domain of O67555_AQUAE.
Residues 3-110 are 30% similar to a GPDA domain of GPDA_BACSU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 3 to 322 (E-value = 7.2e-34) place UU382 in the NAD_Gly3P_dh family which is described as NAD-dependent glycerol-3-phosphate dehydrogenase (PF01210)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
73  
105
transmembrane  
186  
207

PDB Hit:


Gene Protein Sequence:
MSKILIVGSGAFGSALTQVLVSNSHIVDVYGINENELNDLKENQKNKKYF
QDQKLDLPINNTYLDINLALQNQYDFIIIAIPSFAIKNFVDNIKIFNLSK
TIVVNAAKGLNLETKSSWCDYIKQNLKIKALVGLVGPSFAIDVFLKKPTV
VNLVGNNSNALIKVKEEFENNWFKCILSKQFDAANYISCFKNALAIGCGI
IYGLQNSNNSLVAFLTKGINEMQLILEKIFHKKVNPLEYFFIGDTILTCT
DQKSRNFSFGLLIAQQGVQEALVNKQQTIEGLNNIKVIYEIIKTNQISAP
LFQNLYKVIINALNPQDLFDKSFC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAAAATTTTAATTGTTGGAAGCGGAGCTTTTGGAAGTGCTTTAAC
ACAAGTTTTAGTTTCAAATTCTCATATTGTTGATGTTTATGGAATTAATG
AAAATGAGCTTAATGATTTGAAAGAAAATCAAAAAAATAAGAAATATTTT
CAGGATCAAAAATTAGATTTACCAATTAATAATACATATTTGGATATTAA
TTTAGCACTTCAGAATCAATATGATTTTATCATCATTGCTATTCCTTCAT
TTGCTATTAAAAACTTTGTTGATAATATCAAAATTTTTAATTTATCAAAA
ACTATTGTTGTTAATGCAGCGAAAGGATTAAATCTTGAAACAAAATCATC
ATGGTGTGATTATATTAAACAAAATTTAAAAATTAAAGCCTTAGTTGGAT
TAGTTGGCCCTTCATTTGCAATTGATGTTTTTTTAAAAAAACCAACAGTC
GTTAATTTAGTAGGCAATAATTCAAACGCCCTTATAAAAGTTAAAGAAGA
ATTTGAAAACAATTGATTTAAATGCATTTTATCTAAACAGTTTGATGCTG
CTAATTATATTTCTTGTTTTAAAAATGCATTAGCAATAGGTTGTGGTATC
ATTTATGGATTACAAAATTCAAATAATTCTTTAGTAGCTTTTTTAACTAA
AGGAATCAATGAAATGCAACTAATTTTAGAGAAAATTTTTCACAAAAAAG
TCAATCCGTTAGAATACTTTTTTATTGGTGATACAATTTTAACTTGTACT
GATCAAAAATCACGTAATTTTAGTTTTGGTTTACTGATTGCACAACAAGG
CGTACAAGAAGCTTTAGTAAATAAACAACAGACTATTGAAGGTTTAAATA
ACATCAAAGTTATTTATGAAATTATTAAAACAAATCAAATTAGTGCTCCA
CTTTTCCAAAATTTATATAAGGTAATTATTAACGCCTTAAATCCCCAGGA
TTTATTTGATAAAAGTTTTTGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy