Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR309 IGR308 IGR312 IGR310 IGR313 IGR311 IGR314 UU373 UU374 tnp, - UU372 UU376 mba, - UU375 deoA, - UU368 leuS, - UU371 alaS, - UU369 UU373 UU374 tnp, - UU372 UU376 mba, - UU375 deoA, - UU368 leuS, - UU371 alaS, - UU369 Type: tandem, Name:  - 237 Type: tandem, Name:  - 238 Type: tandem, Name:  - 449 UU374 tnp, - UU372 UU376 mba, - UU375 UU373 deoA, - UU368 leuS, - UU371 alaS, - UU369 UU370 UU370
* Calculated from Protein Sequence

Gene ID: UU371

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
leuS  

Definition:
leucyl-tRNA synthetase

Gene Start:
423256

Gene Stop:
425676

Gene Length:
2421

Molecular Weight*:
93294

pI*:
6.80

Net Charge*:
-2.06

EC:
6.1.1.4  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Valine, leucine and isoleucine biosynthesis

Comment:
The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to leucyl-tRNA synthetases, e.g. residues 2-786 are 53% similar to SYL_BACSU. UU371 is similar to MG266, CT209, and TP0586, predicted LeuS sequences. It is also similar to MG334, a predicted ValS, and to MG345 and CT019, predicted IleS proteins.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0495 is ehgpcmYu.
Cog name: Leucyl-tRNA synthetase.
Functional class: J.
BeTs to -hg-c-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 43-52 and 577-587 are similar to blocks BL00178A,B, concerned with class I aminoacyl-tRNA synthetases, e.g. SYL_BACSU.

ProDom Summary:  Protein Domain Search
Residues 415-568 are 59% similar to a Leu-tRNA synthetase domain of SYL_MYCGE. Several stretches, 40-158, 149-227, 180-227, 322-414, 570-635, 686-786, are also similar to SYL domains of SYL_ACSU and SYL_MYCGE.

Paralogs:  Local Blast Search
UU371 is paralogously related to UU267, a predicted valyl-tRNA synthetase. Residues 2-805 are 22% similar to UU267.

Pfam Summary:  Pfam Search
Residues 10 to 620 (E-value = 1.6e-139) place UU371 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
643  
674

PDB Hit:
gi|4930049|pdb|1ILE| Isoleucyl-Trna Synthetase

Gene Protein Sequence:
MYNHNKIEKKWQKYWLDNKTFKFVDNPNNPKKFYVLDMFPYPSGKGLHVG
HPKGYTATDVISRFKRLNGYDVLHPIGWDAFGLPAEQYALETNNHPHTFT
QQNIKIFRKQLQMIGFDFDYDKEVDTTDPQFYQWTQWIFVQLYKHNLAEI
QDIDVNWCENLGTVLSNEEVVLNDKNERVSERGGHPVVRKPMKQWVLKIV
DYADKLLDGLNEVEFSESLKSLQRNWIGKSIGTSVQFKIKDSLLTLDVFT
TRIDTIYGVQYLVVAPEHPILKSITSEQQINVVQSYIEQTKKISDLDRIA
DTNKTGVFSGAYAINPINQEIIPIWVSDYVLMNFATGAVMGVPAHDERDY
AFAKKYALPIKSVIDTKQKLPYAGDGLHINSAMINGLNIKQSQNVLNDYL
IKNHLGKKVANYKLRNWIFSRQRYWGEPFPVLFDENNQIKIIEDLPVLLP
NLNEFKPSKTGESPLANAQEWLYVEIDGKKYRRETNTMPQWAGSSWYFLA
YILKNEDGSYTPLNSEEAKKRFAKWLPVDVYIGGQEHAVLHLLYSRFWHR
FLYDIGVVPTKEPFYKVINQGMILGENNEKMSKSKGNVINPDDIIASHGA
DTLRIYEMFMGPLTASLPWNPDGLDAMRKWLDRVYRLYHNLSELEVVEDL
NKLNEEIIIAYHTLIKNYTKAINEQAFNIAISEMMVFVNVLYKNKVINYE
LLDNFLILLSCYAPHLAEELYSLNHSESVCLQKMPIYDEQKIIAQNITIP
IQINGKLKHTINVLRDTNAEELVNLALACEQVKQEIGDQPIKKQIVVVNK
IINFVI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATAATCACAATAAAATTGAAAAAAAATGACAAAAGTATTGACTAGA
TAATAAGACTTTTAAATTTGTTGATAATCCTAACAATCCTAAGAAATTTT
ATGTATTAGACATGTTTCCATATCCTAGTGGAAAAGGATTGCATGTTGGT
CATCCCAAAGGTTATACAGCAACTGATGTAATTAGTCGTTTTAAACGTTT
GAATGGTTATGATGTTTTACATCCAATTGGTTGAGATGCTTTCGGTTTAC
CAGCAGAACAGTATGCATTAGAAACAAATAATCACCCTCATACTTTTACG
CAACAAAATATTAAAATTTTTCGTAAACAATTACAAATGATTGGTTTTGA
TTTTGACTATGATAAAGAAGTTGATACAACCGATCCTCAATTTTATCAAT
GAACGCAATGGATTTTTGTGCAATTATATAAACATAATTTAGCTGAAATT
CAAGATATTGATGTTAATTGATGCGAAAATTTAGGAACTGTTTTAAGTAA
TGAAGAAGTTGTTTTAAATGATAAAAACGAACGGGTAAGTGAGCGAGGTG
GTCATCCTGTTGTTCGTAAACCAATGAAACAATGAGTTTTAAAAATTGTA
GATTATGCTGATAAATTATTAGATGGTTTAAATGAAGTTGAATTTAGTGA
ATCATTAAAATCGTTGCAACGTAATTGAATTGGTAAATCAATCGGTACTA
GTGTGCAATTTAAGATTAAAGATTCACTTTTAACACTTGATGTGTTCACT
ACACGAATTGATACTATTTATGGGGTACAATACTTAGTAGTTGCACCAGA
ACATCCAATTCTTAAATCTATTACTAGTGAGCAACAAATTAATGTTGTTC
AATCATATATTGAACAAACAAAGAAAATAAGCGATTTAGATCGCATTGCT
GATACTAATAAAACTGGTGTTTTTAGTGGTGCATATGCTATTAATCCAAT
CAATCAAGAAATCATTCCAATTTGAGTAAGTGATTATGTTTTAATGAATT
TTGCAACTGGAGCTGTTATGGGTGTACCAGCACATGATGAACGTGATTAT
GCTTTTGCTAAAAAATATGCATTACCAATTAAAAGTGTAATTGATACAAA
ACAAAAATTACCATATGCAGGTGATGGTTTACATATTAACTCAGCAATGA
TTAATGGTTTAAATATTAAACAATCTCAAAATGTTTTAAATGATTATTTA
ATTAAAAATCATCTAGGAAAAAAAGTTGCAAACTATAAATTGCGTAATTG
AATTTTTAGTCGTCAACGTTATTGAGGTGAACCATTCCCAGTTTTATTCG
ATGAAAATAATCAAATAAAGATTATCGAAGACTTACCTGTTTTATTACCA
AATTTAAATGAATTTAAACCTTCTAAAACTGGTGAATCTCCCCTTGCAAA
TGCCCAAGAATGATTATATGTAGAAATTGATGGTAAAAAATATCGTCGCG
AAACAAATACAATGCCACAATGAGCAGGCTCATCATGATATTTTTTAGCT
TATATTTTAAAAAATGAAGATGGTTCATACACACCATTAAATAGTGAAGA
AGCTAAAAAGCGTTTTGCTAAATGATTGCCAGTTGATGTTTATATTGGTG
GACAAGAACATGCTGTTTTACATTTACTATATTCGCGTTTTTGACATCGT
TTTTTGTATGATATTGGTGTAGTGCCAACAAAAGAACCATTTTATAAAGT
AATTAATCAGGGAATGATTTTAGGCGAAAATAATGAAAAAATGTCTAAAT
CAAAAGGGAATGTTATTAATCCTGATGATATTATTGCTTCGCATGGTGCT
GATACATTAAGAATTTATGAAATGTTTATGGGACCATTAACAGCTTCATT
ACCATGAAATCCGGATGGGTTAGATGCGATGCGAAAATGATTAGATCGCG
TTTATCGTTTATATCATAATTTAAGTGAACTAGAAGTTGTCGAAGATCTT
AATAAACTAAATGAAGAAATAATTATTGCCTATCATACTTTAATTAAAAA
TTACACAAAAGCAATTAATGAACAAGCATTTAATATTGCGATTAGTGAAA
TGATGGTTTTTGTTAATGTTTTATACAAAAATAAAGTTATTAATTATGAA
TTATTAGATAATTTTTTAATTTTACTTTCATGCTATGCACCACATTTAGC
GGAGGAATTATATAGTTTAAACCATTCAGAATCTGTTTGTTTACAAAAAA
TGCCTATTTATGATGAACAAAAAATTATTGCTCAAAATATTACAATTCCA
ATTCAAATTAATGGTAAATTAAAGCACACAATCAATGTTTTAAGAGATAC
AAATGCTGAAGAGTTAGTTAATTTAGCATTGGCTTGTGAACAAGTTAAAC
AAGAAATTGGGGATCAACCAATTAAAAAACAAATCGTTGTTGTTAATAAA
ATTATTAATTTTGTTATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy