Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR309 IGR308 IGR306 IGR310 IGR307 tnp, - UU372 UU366 UU367 deoA, - UU368 leuS, - UU371 alaS, - UU369 tnp, - UU372 UU366 UU367 deoA, - UU368 leuS, - UU371 alaS, - UU369 Type: tandem, Name:  - 236 Type: tandem, Name:  - 237 Type: tandem, Name:  - 448 tnp, - UU372 UU366 UU367 deoA, - UU368 leuS, - UU371 alaS, - UU369 UU370 UU370
* Calculated from Protein Sequence

Gene ID: UU369

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
alaS  

Definition:
alanyl-tRNA synthetase

Gene Start:
420084

Gene Stop:
422804

Gene Length:
2721

Molecular Weight*:
105187

pI*:
6.30

Net Charge*:
-13.62

EC:
6.1.1.7  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Alanine and Aspartate metabolism
Aminoacyl-tRNA biosynthesis

Comment:
The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to alanyl-tRNA synthetases, e.g. residues 2-900 are 42% similar to MYCPN. UU369 is similar to MG292, CT749, and TP1017, all predicted ala-tRNA synthetases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0013 is ehgpcmYu.
Cog name: Alanyl-tRNA synthetase.
Functional class: J.
BeTs to -h-pcmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 8-886 span eleven regions of similarity to blocks PD01168A-I, K,L, which encompass alanyl-tRNA synthetase sequences.


ProDom Summary:  Protein Domain Search
Residues 5-258, 283-442, 475-556, and 563-706 are 65%, 41%, 48%, and 39% similar to SYA domains of SYA_MYCPN and SYA_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 8 to 713 (E-value = 6.8e-285) place UU369 in the tRNA-synt_2c family which is described as tRNA synthetases class II (A) (PF01411)
Residues 829 to 901 (E-value = 3.1e-11) place UU369 in the DHHA1 family which is described as DHHA1 domain (PF02272)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
611  
645
non-globular  
709  
747
coil-coil  
752  
786
non-globular  
789  
906

PDB Hit:


Gene Protein Sequence:
MLKLSTNEIRKKWIEFFESKDHLFIEPKSLIPKNDPTLLWINSGVSTLKD
YFSGKVKPPHKRLVNSQKAIRTNDIFNVGLTSRHHTFFEMLGNFSIGDYF
KKEAIDWAYEFLINVLKIDVKKLWVTVFEDDQFTNDEWIKLGIIKEQIIK
CNRDRNFWDVGNGPCGPCTEIHYDRGERFDPNKIGSKLILEDIENDRYVE
IWNIVFSQFNNDGHNNYTELLQKNIDTGAGLERIACISQDVPTNFDSDVF
MRITKSVEQFSEYKYDMNEYFHPNVTQNKINFAYKVIADHMRATVFAIAD
GAIPSNKERGYILRRLIRRTMVLVRRLNINNLLWVDAVVDAIASTMGDFY
TYLKDEKTLTKIKMILNKEVQLFEKTLQLGLNIFENSIRNQELDKEITFK
LVDTYGFPIELIKEICEQRNVKVDLEAFDAMFKHHQLISKANKANLKVME
SQNESLMQLDVDSTFHYEIFRWENAKIITLFNEDFELVDGLDHEDGYVVF
DNTCFYATSGGQQHDTGYIIKNDQQFFVDDVFKAPNRQHVHHVKNASLSM
NEHVILQINEQDRKSITANHTAEHLLHYCLKHVLSPDIKQEGAAKYPHKV
TFDFTYHAQPTKAQLDKLENVLNEMVQSNFDVQELHMDLDEAKAVGAAAY
FEDVYKKLKGKLRVIKMGPSIELCGGTHAHHTSEIERIKIVECASKGAGS
WRITMVTGHDNLAKYIHDLYVDYLNEINHLKVNLDINDHKLNDLYNAFAN
WKNLSIDDYDLLNEKFAELKQSLINFKIEFDKQNAKQAIIDIKNTFNTQL
TNKRVHVFKNTDNKNIFNALNELINENQDTLFISFNLDDNKIQYLLAINE
KFATTNQINLNKYIKELNTISNGKGGGKPYFVQGGTSEQEKLDELLTVVD
KWVINA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGAAATTAAGTACGAATGAGATTAGAAAAAAGTGAATTGAATTTTT
TGAGTCAAAGGATCATTTATTTATTGAACCAAAGTCATTAATTCCCAAAA
ACGACCCTACACTATTATGAATTAATTCTGGTGTTTCAACCTTAAAAGAT
TATTTTAGTGGTAAGGTTAAACCACCACATAAACGTTTAGTTAATTCTCA
AAAAGCTATTCGTACAAATGATATTTTTAATGTTGGATTAACGAGCCGTC
ACCATACTTTTTTTGAAATGTTAGGGAATTTTTCAATTGGTGATTATTTT
AAAAAAGAAGCTATTGATTGAGCTTATGAATTTTTAATTAACGTTTTAAA
AATTGATGTAAAAAAACTATGAGTAACTGTTTTTGAAGATGATCAATTTA
CGAATGATGAATGAATTAAATTAGGAATTATTAAAGAGCAAATTATTAAA
TGCAATCGTGATCGTAATTTTTGAGATGTAGGTAATGGCCCTTGCGGCCC
ATGTACTGAAATTCATTATGATCGTGGTGAACGTTTTGACCCAAATAAAA
TAGGATCAAAATTAATTTTAGAAGATATTGAAAATGATCGTTATGTTGAA
ATTTGAAATATTGTTTTCTCACAATTTAATAATGATGGCCATAACAATTA
CACTGAATTATTACAAAAAAATATCGATACAGGAGCTGGCTTGGAAAGAA
TTGCTTGTATTTCACAAGATGTACCAACTAACTTTGATAGCGATGTTTTT
ATGCGAATTACAAAAAGTGTTGAACAGTTTTCAGAATATAAATATGACAT
GAATGAATACTTTCATCCCAATGTTACTCAAAATAAAATTAATTTCGCTT
ATAAAGTAATTGCAGATCATATGCGTGCAACTGTTTTTGCGATTGCAGAT
GGTGCAATTCCTTCAAATAAAGAACGAGGTTACATTTTACGTCGTTTAAT
TCGTCGAACTATGGTTTTAGTGCGTCGTTTAAATATTAACAATCTTTTAT
GAGTTGATGCAGTTGTTGACGCTATCGCTTCAACAATGGGTGATTTTTAT
ACTTATTTAAAAGATGAAAAAACACTTACTAAAATTAAAATGATTTTAAA
TAAAGAAGTGCAATTATTTGAAAAAACTTTACAATTAGGTTTAAATATTT
TTGAAAATTCTATTCGTAATCAAGAATTAGATAAAGAAATTACTTTTAAA
CTAGTTGATACATATGGTTTTCCAATTGAATTAATTAAAGAAATTTGTGA
ACAACGTAATGTTAAAGTTGATTTAGAAGCTTTTGATGCTATGTTTAAAC
ATCACCAATTAATTTCAAAAGCAAACAAAGCTAATTTAAAAGTAATGGAA
TCACAAAACGAATCACTAATGCAATTAGATGTTGATTCAACCTTTCACTA
TGAAATATTTAGATGAGAAAATGCTAAAATCATTACTTTATTTAATGAGG
ATTTTGAATTGGTTGATGGTTTAGATCATGAAGATGGTTATGTTGTTTTT
GATAACACATGTTTTTATGCAACATCAGGTGGTCAACAACATGACACAGG
TTATATTATTAAAAATGATCAACAATTTTTTGTTGATGATGTTTTTAAGG
CACCTAATCGTCAACACGTTCATCATGTTAAAAATGCTAGTTTATCAATG
AATGAGCATGTTATTTTACAAATCAACGAGCAAGATCGTAAATCAATTAC
AGCAAACCATACAGCCGAACACTTATTACACTATTGCTTAAAACATGTTT
TAAGTCCTGATATTAAACAAGAAGGAGCTGCTAAATATCCACATAAAGTA
ACATTTGATTTTACTTATCATGCTCAACCAACAAAAGCACAATTAGATAA
GTTAGAAAATGTATTAAATGAAATGGTACAAAGTAATTTTGATGTACAAG
AATTACACATGGATTTAGATGAAGCTAAAGCTGTTGGTGCTGCTGCTTAT
TTTGAAGATGTTTATAAAAAATTAAAAGGCAAATTACGTGTAATTAAAAT
GGGACCTTCAATTGAGTTATGTGGGGGTACACACGCACATCATACATCAG
AAATCGAGCGAATTAAAATTGTTGAATGTGCTTCTAAAGGGGCTGGCTCT
TGAAGAATTACTATGGTAACAGGTCATGATAATTTAGCAAAATACATTCA
TGATTTATATGTAGACTACTTAAATGAAATCAATCACTTAAAAGTTAATT
TAGATATTAATGATCATAAATTAAATGATTTATATAATGCTTTTGCAAAT
TGAAAAAATCTATCAATTGATGATTATGATTTATTAAATGAAAAATTTGC
TGAACTAAAACAATCATTAATTAATTTTAAAATCGAATTTGATAAACAAA
ATGCCAAACAAGCTATTATTGATATTAAAAACACTTTTAATACACAACTA
ACTAATAAACGTGTACACGTTTTTAAAAACACTGATAATAAAAATATCTT
CAATGCTTTAAATGAATTAATTAACGAAAATCAAGATACATTATTTATTA
GTTTCAACTTAGATGATAATAAAATTCAATATTTATTAGCAATTAATGAA
AAGTTTGCTACTACAAACCAAATTAATTTAAATAAATATATTAAAGAATT
AAATACTATTTCTAATGGTAAAGGTGGGGGCAAGCCATATTTTGTTCAAG
GTGGAACAAGTGAACAAGAAAAATTAGATGAGTTATTAACTGTTGTAGAT
AAATGAGTTATTAATGCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy